BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060414.seq (550 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.088 SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_25160| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.47 SB_25688| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_54552| Best HMM Match : Vicilin_N (HMM E-Value=0.87) 31 0.82 SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_45863| Best HMM Match : Peptidase_M10 (HMM E-Value=9e-31) 30 1.4 SB_39366| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_13140| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-15) 29 1.9 SB_10560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_5103| Best HMM Match : Vicilin_N (HMM E-Value=0.36) 29 1.9 SB_20267| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_20263| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_20262| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_52732| Best HMM Match : M (HMM E-Value=0.019) 29 3.3 SB_51758| Best HMM Match : MNNL (HMM E-Value=1.2) 29 3.3 SB_46824| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_40279| Best HMM Match : zf-MYM (HMM E-Value=0.66) 29 3.3 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 28 4.4 SB_54036| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_13278| Best HMM Match : zf-CHC2 (HMM E-Value=6.8) 28 4.4 SB_56740| Best HMM Match : RBD (HMM E-Value=0.21) 28 5.8 SB_53658| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_28750| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_42885| Best HMM Match : DUF983 (HMM E-Value=9.7) 28 5.8 SB_32955| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_26399| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_56807| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_14704| Best HMM Match : Mak16 (HMM E-Value=9.3) 27 7.6 SB_10201| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_4148| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 33.9 bits (74), Expect = 0.088 Identities = 14/52 (26%), Positives = 29/52 (55%) Frame = +3 Query: 99 RKPENIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 R N+ + ++ + EK+ +N +N+ E + N+ ++ ++SNN D S N Sbjct: 323 RNDHNVDNNSHNNDEKNKSNSNDNNDENNNNNSNNKDSNNKSNNNDNKSNSN 374 Score = 30.7 bits (66), Expect = 0.82 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +3 Query: 108 ENIGSQNNIDIEKHAN--NEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 +N + NN D + N N N + VD N+ ++ ++SN+ D + E N Sbjct: 301 DNNSNSNNNDNNSNNNDFNNSNRNDHNVDNNSHNNDEKNKSNSNDNNDENN 351 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/45 (26%), Positives = 19/45 (42%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISS 245 N N + H N NN+ D N+ + + SNN D ++ Sbjct: 276 NNHGNNKSNSNDHNNENNNNNSNNNDNNSNSNNNDNNSNNNDFNN 320 >SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 33.1 bits (72), Expect = 0.15 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 120 SQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 + NN D + NN NN+ D N++ + NN+D +S+ N Sbjct: 598 NDNNSDNNNNNNNNNNNNNNNNDNNSDNNSDNNSDNNSDNNSDNN 642 Score = 31.1 bits (67), Expect = 0.62 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +3 Query: 120 SQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 S NN + + NN NN+ D N++ + NN+D +++ N Sbjct: 602 SDNNNNNNNNNNNNNNNNDNNSDNNSDNNSDNNSDNNSDNNNDNN 646 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +3 Query: 120 SQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 + NN D NN NN+ + N + + NN+D +S+ N Sbjct: 594 NDNNNDNNSDNNNNNNNNNNNNNNNNDNNSDNNSDNNSDNNSDNN 638 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +3 Query: 120 SQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQ 251 + NN + + NN NN D N++ + NN D +SE+ Sbjct: 606 NNNNNNNNNNNNNNDNNSDNNSDNNSDNNSDNNSDNNNDNNSER 649 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/50 (24%), Positives = 23/50 (46%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQNLK 260 N + NN + + NN NN D N++ + NN++ ++ +K Sbjct: 607 NNNNNNNNNNNNNDNNSDNNSDNNSDNNSDNNSDNNNDNNSERGADPEIK 656 >SB_25160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 31.5 bits (68), Expect = 0.47 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = +3 Query: 108 ENIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQNLK 260 +N S NN D K NN NN + N + I+ SNN +I+S + K Sbjct: 65 DNKDSNNNNDRNKKNNNNNNNSNNNNNNNNRNQNNIN-SNNKNINSNNDNK 114 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 N S NN I + NN K+N ++ + N + +K + +NN ++ N Sbjct: 46 NKASDNN-SINGNNNNNKSNDNKDSNNNNDRNKKNNNNNNNSNNNNNN 92 >SB_25688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 629 Score = 31.1 bits (67), Expect = 0.62 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +3 Query: 108 ENIGSQNNIDIEKHANNEKN-NHVEEVDQNAETEEKIH 218 +NI Q NID +KH + +K+ N + +DQ +++ H Sbjct: 584 KNIDQQKNIDQQKHIDQQKHINQQKHIDQQKHIDQQKH 621 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/46 (23%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +3 Query: 123 QNNIDIEKHANNEKN-NHVEEVDQNAETEEKIHRSNNTDISSEQNL 257 Q +ID +KH + +KN + + +DQ +++ H + I ++++ Sbjct: 571 QKHIDQQKHIDQQKNIDQQKNIDQQKHIDQQKHINQQKHIDQQKHI 616 >SB_54552| Best HMM Match : Vicilin_N (HMM E-Value=0.87) Length = 188 Score = 30.7 bits (66), Expect = 0.82 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +3 Query: 123 QNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQ 251 QNN + + NN NN EEVD+ A T NN + +E+ Sbjct: 142 QNNNN--NNNNNNNNNETEEVDREAATRTPSPNENNNNNETEE 182 >SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 123 QNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 QNN + + NN NN EEVD+ A T + N + E N Sbjct: 8 QNNNNNNNNNNNNNNNETEEVDREAAT--RTPSPNEQQVIQENN 49 >SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 123 QNNIDIEKHANNEKNNHVEEVDQNAET 203 QNN + + NN NN EEVD+ A T Sbjct: 8 QNNNNNNNNNNNNNNNETEEVDREAAT 34 >SB_45863| Best HMM Match : Peptidase_M10 (HMM E-Value=9e-31) Length = 273 Score = 29.9 bits (64), Expect = 1.4 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 N + NN + + NN NN++ + N I+ +NN + ++ N Sbjct: 214 NNNNNNNNNNNNNNNNNNNNNINNNNNNINNNNNINNNNNINNNNNNN 261 >SB_39366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQNL 257 N + NN + + NN NN+ + N + +NN + ++EQNL Sbjct: 15 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNDNNNNNNNNNNNEQNL 63 >SB_13140| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-15) Length = 987 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +3 Query: 111 NIGSQNN-IDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISS 245 N +QNN I ++ANNE N N ++++ R +N DIS+ Sbjct: 896 NSNNQNNSIGSPENANNEDANRCTHNQNNPKSKDNAIRRSNRDISN 941 >SB_10560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +3 Query: 123 QNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISS 245 ++N +KH NN +N++ +D+N +HR+ N + +S Sbjct: 276 RHNTFYKKHQNNYENDYFTNLDKNYARFSCVHRTPNWNFTS 316 >SB_5103| Best HMM Match : Vicilin_N (HMM E-Value=0.36) Length = 592 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAET 203 N + NN + + NN NN EEVD+ A T Sbjct: 366 NNNNNNNNNNNNNNNNNNNNETEEVDREAAT 396 >SB_20267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/48 (25%), Positives = 24/48 (50%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 N + +N D + + NN+KN++ + D N + + NN + + N Sbjct: 213 NYDNNDNNDNDNNDNNDKNDNNDNNDNNGNNDNYDNNDNNDNNDNNDN 260 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/48 (22%), Positives = 25/48 (52%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 N + NN + + + NN+ N++ + D N ++ + NN + ++ N Sbjct: 237 NDNNGNNDNYDNNDNNDNNDNNDNNDNNDNNDKNDNNDNNDNYNNNGN 284 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/48 (22%), Positives = 22/48 (45%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 N + NN + + NN+ N++ + D N + + NN + + N Sbjct: 321 NGNNGNNDNYNNYDNNDNNDNNDNYDNNGNNDNNDNYDNNDNYDNNDN 368 >SB_20263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/48 (22%), Positives = 24/48 (50%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 N + NN + + + NN+ N++ + D N + + NN + ++ N Sbjct: 13 NDNNDNNDNYDNNGNNDSNDNGDNCDNNDNYDNNDNNGNNDNNDNDDN 60 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/48 (22%), Positives = 22/48 (45%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 N + NN + + + NN+ N++ D N + + NN + + N Sbjct: 85 NDNNDNNDNYDNNGNNDNNDNYNNYDNNGNNDSNDNNGNNDNNDNYDN 132 >SB_20262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/49 (22%), Positives = 23/49 (46%) Frame = +3 Query: 108 ENIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 +N + NN + + + NN N++ + D N + + NN + + N Sbjct: 153 DNDNNDNNYNYDNNDNNGNNDNYDNNDNNDNNDNNDNNDNNDNYDNNDN 201 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/48 (22%), Positives = 22/48 (45%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 N NN + + + NN+ N++ + D N + + NN + + N Sbjct: 127 NDNYDNNYNNDNNDNNDNNDNYDNYDDNDNNDNNYNYDNNDNNGNNDN 174 Score = 27.5 bits (58), Expect = 7.6 Identities = 10/45 (22%), Positives = 21/45 (46%) Frame = +3 Query: 120 SQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 + NN + + NN+ N++ + D N + + NN + + N Sbjct: 43 NDNNDSNDNNGNNDNNDNNDNYDNNGNNDSNDNNDNNDNNDNNDN 87 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/48 (22%), Positives = 23/48 (47%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 N + NN + + + NN+ N++ + D N + + NN + + N Sbjct: 73 NDNNDNNDNNDNNDNNDNNDNYDNNDNNGNNDNNDNNDNNDNNDNNGN 120 >SB_52732| Best HMM Match : M (HMM E-Value=0.019) Length = 1366 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +3 Query: 108 ENIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 E G + +DI VEE+++ E E + N +ISS+++ Sbjct: 653 EKYGLERRLDILVKERKNLQGRVEELEEMLEAEREKQHKKNEEISSDED 701 >SB_51758| Best HMM Match : MNNL (HMM E-Value=1.2) Length = 326 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = +3 Query: 108 ENIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQNLK 260 +N + NN + + NN NN+ + N + +NN D SS +K Sbjct: 153 DNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDTSSCSAIK 203 >SB_46824| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 28.7 bits (61), Expect = 3.3 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +3 Query: 108 ENIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQNLK 260 +N S NN D K NN NN+ + N + SNN +I+S + K Sbjct: 46 DNKDSNNNNDRNK--NNNNNNNSNNNNNNNNRNQNNINSNNNNINSNNDNK 94 >SB_40279| Best HMM Match : zf-MYM (HMM E-Value=0.66) Length = 364 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 439 CRK*R*NGKSERSGDQIQESDEDKKLMKMWKEVN 540 C++ R GK+ R D Q DK + KMW N Sbjct: 168 CKERRPQGKTSRPLDVCQRCKRDKNVPKMWSAEN 201 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 28.3 bits (60), Expect = 4.4 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = +3 Query: 159 EKNNHVEEVDQNAETEEKIHRSNNTDISSEQNLK**LQMRRNK*TAM--EMRLV*KNRIK 332 EKN +++ + +K +++T + +NLK LQM + +A+ EM+ + + ++K Sbjct: 2396 EKNELTSQIESLVDKVKKYEEASSTVMKENENLKRNLQMETRQLSAVKEEMKQL-RGKLK 2454 Query: 333 TQ 338 TQ Sbjct: 2455 TQ 2456 >SB_54036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 N ++NN + + NN NN+ + N + +NN +I + N Sbjct: 30 NNNNKNNYNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNIKNNNN 77 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQNLK 260 N + NN + + + NN NN+ + N + +NN + ++ N+K Sbjct: 24 NNNNNNNNNNKNNYNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNIK 73 >SB_13278| Best HMM Match : zf-CHC2 (HMM E-Value=6.8) Length = 152 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 N + NN + + NN NN+ + N + SNN + SS N Sbjct: 102 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNSNNNSNNNNNSSSSN 149 >SB_56740| Best HMM Match : RBD (HMM E-Value=0.21) Length = 320 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +3 Query: 147 HANNEKNNHVEEVDQNAETEEKIHRSNNTDISS 245 H +NE H ++D A+ E K + NN ++S Sbjct: 264 HRDNETKRHTIDLDSRADPETKPRQLNNNALNS 296 >SB_53658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 5.8 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 126 NNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSN-NTDISS 245 NN + + H NN NN+ + D N + H S+ N DIS+ Sbjct: 101 NNNNNDHHDNNNNNNNNDHHDNNNNSLNHNHTSSRNGDISA 141 >SB_28750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = +3 Query: 117 GSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 G+ NN + NN NN+ + N + +NN D +S+++ Sbjct: 6 GNNNNNKNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDDNSDED 51 >SB_42885| Best HMM Match : DUF983 (HMM E-Value=9.7) Length = 152 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = +3 Query: 108 ENIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 +N NN D + N++KN+ ++ D N +E + S ++D ++ + Sbjct: 16 DNTSFYNNYDNDDDNNDDKNDDADKDDDNDVDDEDDNNSFDSDYGNDDD 64 >SB_32955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 7.6 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = +3 Query: 120 SQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 SQNN + NN NN EEVD+ A T I + Q+ Sbjct: 7 SQNNTN----NNNNNNNETEEVDREAATRTPSPNEQQVQIPTAQS 47 >SB_26399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 27.5 bits (58), Expect = 7.6 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +3 Query: 129 NIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 ++D +H NN NN+ + N + +NN + ++ N Sbjct: 32 HVDFNEHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 73 >SB_56807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/49 (26%), Positives = 30/49 (61%) Frame = +3 Query: 108 ENIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 EN+ NN D + + +N+ NN+ + D N ++K + +N+ + ++++N Sbjct: 12 ENVCDANN-DNDNNKDNDNNNNNNDKDNN-NNKDKNNNNNDKNNNNDKN 58 >SB_14704| Best HMM Match : Mak16 (HMM E-Value=9.3) Length = 189 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/48 (22%), Positives = 24/48 (50%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 N + NNI+ + NN NN++ + N + +NN + +++ + Sbjct: 99 NNNNNNNINNINNNNNNNNNNINNNNNNNNNNNNNNNNNNNNNNNDDD 146 >SB_10201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1162 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +3 Query: 108 ENIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTD 236 EN Q + D++KH NN NN E D E + T+ Sbjct: 1106 ENNARQEDGDLDKHDNNNNNNSNETDDAPVGEENHAGDAETTE 1148 >SB_4148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTD 236 N + NN D +NN NN+ ++N + + +NN + Sbjct: 19 NSSNNNNNDSNNSSNNSSNNNSNNNNRNNSSNSNSNNNNNNN 60 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 N + NN + ++N+ NN+ + N+ + SNN + S+ N Sbjct: 38 NNSNNNNRNNSSNSNSNNNNNNNNRNNNSNNNNSNNNSNNNNRSNRNN 85 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = +3 Query: 111 NIGSQNNIDIEKHANNEKNNHVEEVDQNAETEEKIHRSNNTDISSEQN 254 N S NN + NN NN+ N + + SNN + ++ N Sbjct: 50 NSNSNNNNNNNNRNNNSNNNNSNNNSNNNNRSNRNNNSNNNNRNNNSN 97 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,427,875 Number of Sequences: 59808 Number of extensions: 135206 Number of successful extensions: 1933 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1567 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -