BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060413.seq (567 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 25 1.3 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 25 1.3 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 2.3 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 25 2.3 AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranfe... 23 6.9 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 6.9 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 9.2 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 25.4 bits (53), Expect = 1.3 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +3 Query: 90 IQQHSNRNKSSAPSEFNSKCRHCRRCASNGGRAVTKI 200 +Q H N + + P +C+HC C + G + I Sbjct: 170 LQNHVNTHTGTKPH----RCKHCDNCFTTSGELIRHI 202 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 25.4 bits (53), Expect = 1.3 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -3 Query: 454 IRIPASLMFGSCALAQLNM 398 + +P +L+FGS L QLN+ Sbjct: 341 VSLPGTLLFGSANLTQLNL 359 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.6 bits (51), Expect = 2.3 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 259 SENNCYSPFKWIFPST 306 S NNC++P KW + S+ Sbjct: 2756 SANNCWNPLKWDWRSS 2771 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 24.6 bits (51), Expect = 2.3 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 421 CALAQLNMNCRNSGHWLLP-SSSI*FLASSET 329 C + +L+ RN+G+W+ + +ASSET Sbjct: 30 CLMVELHSVPRNNGNWVADRDGKVAIIASSET 61 >AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranferase d9 protein. Length = 216 Score = 23.0 bits (47), Expect = 6.9 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 412 PVRKIQTSKKLVFECLRLYQ 471 P+R+ +++L+FEC LY+ Sbjct: 88 PLRRAIVNQRLLFECGTLYK 107 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.0 bits (47), Expect = 6.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 431 HQRSWYSNVYVCTR 472 H +SW SNV C+R Sbjct: 766 HDQSWSSNVVDCSR 779 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 22.6 bits (46), Expect = 9.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 312 RKVCDVVSELARNH 353 RK+ D V+ L RNH Sbjct: 822 RKIADAVTRLLRNH 835 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,712 Number of Sequences: 2352 Number of extensions: 11532 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -