BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060413.seq (567 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 2.1 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 3.7 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 3.7 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 3.7 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.0 bits (47), Expect = 2.1 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = -3 Query: 484 FPNTP-GTDVNI--RIPASLMFGSCALAQLNMNCRNSGHWLLPS 362 FP TP G +V + + + + + + Q C+ G W LPS Sbjct: 201 FPATPTGREVALIEQTIGTCVANAVVIEQPTFLCKGDGKWYLPS 244 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 7 EGDQAQFYQLLNTLLSTDNDIRSQA 81 +G QAQ + NT LS DN S + Sbjct: 16 QGTQAQHWSRGNTWLSLDNSNMSMS 40 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 7 EGDQAQFYQLLNTLLSTDNDIRSQA 81 +G QAQ + NT LS DN S + Sbjct: 16 QGTQAQHWSRGNTWLSLDNSNMSMS 40 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.2 bits (45), Expect = 3.7 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +3 Query: 84 GRIQQHSNRNKSSAPSEFNSKCRHCRR 164 G I+ + + K+ P EF +C+ R+ Sbjct: 134 GNIEAVTTKEKAKFPQEFFPECKWSRK 160 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,331 Number of Sequences: 438 Number of extensions: 3007 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -