BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060411.seq (563 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0101 + 14611622-14613133 28 4.5 07_03_1697 - 28795521-28797328,28797430-28797550 27 7.8 >09_04_0101 + 14611622-14613133 Length = 503 Score = 28.3 bits (60), Expect = 4.5 Identities = 18/54 (33%), Positives = 28/54 (51%) Frame = -3 Query: 480 HLIPVSTHILGSIGIGTRIPLKVARKIALTDCRTHPAHRYMILLMST*QVPLFN 319 HL + H+L S + P+ + R I+L + H AHR ++ L S + LFN Sbjct: 21 HLRQIHAHLLTSGRFPSLGPVLLRRLISLPNPHLHLAHRLLLSLPSP-SLDLFN 73 >07_03_1697 - 28795521-28797328,28797430-28797550 Length = 642 Score = 27.5 bits (58), Expect = 7.8 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 430 CPDTYATKNMSGNGNQVPLAPNQRGPGL 513 C T KN +GN +V AP+ G GL Sbjct: 35 CGTTLRAKNRTGNSQEVISAPSSLGSGL 62 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,614,582 Number of Sequences: 37544 Number of extensions: 299389 Number of successful extensions: 603 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1293275844 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -