BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060411.seq (563 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18760| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_31791| Best HMM Match : PIG-U (HMM E-Value=0.15) 28 6.1 >SB_18760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1569 Score = 30.7 bits (66), Expect = 0.86 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 450 QEYEWKRESGAAGAQPTRARPYPRASTPHRPVECYHPT 563 +E + KR +G A A+PTR+ R+ T P E PT Sbjct: 1373 EEVQPKRATGKASAKPTRSTRGKRSQTDEAPAEGEKPT 1410 >SB_31791| Best HMM Match : PIG-U (HMM E-Value=0.15) Length = 1366 Score = 27.9 bits (59), Expect = 6.1 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 326 SGTCQVDISKIIYLCAGC 379 SG C ++I+K+IY C C Sbjct: 771 SGKCSINITKLIYECKSC 788 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,233,327 Number of Sequences: 59808 Number of extensions: 367249 Number of successful extensions: 622 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -