BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060406.seq (557 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 21 5.4 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 9.5 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 9.5 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 9.5 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 9.5 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 5.4 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 157 SVFT*KTN-SVQIITYFHSTFMCVQYLSFHLIDSF 56 +++T N S ++ Y HS Y SF+ D F Sbjct: 102 TIYTTHVNASFDVVVYIHSGAFMTGYGSFYQPDYF 136 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 162 YNAMLPRRRNIGVTERLLETE 224 YN L RRR I + L+ +E Sbjct: 254 YNRYLTRRRRIEIAHTLVLSE 274 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 162 YNAMLPRRRNIGVTERLLETE 224 YN L RRR I + L+ +E Sbjct: 254 YNRYLTRRRRIEIAHTLVLSE 274 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +2 Query: 446 KPTVRDDRKAAVLETYSQFMSWPK 517 KPT R V T S WP+ Sbjct: 498 KPTEFACRPGTVFHTQSNICDWPE 521 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 162 YNAMLPRRRNIGVTERLLETE 224 YN L RRR I + L+ +E Sbjct: 254 YNRYLTRRRRIEIAHTLVLSE 274 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,012 Number of Sequences: 336 Number of extensions: 2252 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13681771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -