BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060404.seq (550 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 6.2 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 8.2 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.4 bits (43), Expect = 6.2 Identities = 10/39 (25%), Positives = 20/39 (51%) Frame = +3 Query: 123 TDYYARKRLVVXXKNKXNTPKYRLIVRLSNKDVTCQVAY 239 TD RK ++ + K ++ ++V + N+D +AY Sbjct: 288 TDTLIRKYIIPKEQVKEDSLYTNIVVDIRNEDCGSAIAY 326 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -3 Query: 302 HHNVATHVNKQRTQ 261 HHNV H RTQ Sbjct: 1680 HHNVNKHCTIHRTQ 1693 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,981 Number of Sequences: 438 Number of extensions: 2425 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -