BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060402.seq (538 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL158822-4|CAI39240.1| 1315|Homo sapiens potassium channel, subf... 30 6.0 AB037843-1|BAA92660.1| 1151|Homo sapiens KIAA1422 protein protein. 30 6.0 >AL158822-4|CAI39240.1| 1315|Homo sapiens potassium channel, subfamily T, member 1 protein. Length = 1315 Score = 29.9 bits (64), Expect = 6.0 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Frame = -3 Query: 431 FNWALFRFCFDLSNQWF-TCSFQHFHHLRKSVSIMDKVIYCTI---SLGHFLHTP*IWTS 264 FN L FC L + TC QH +++S++ +C + ++G+ TP IW S Sbjct: 334 FNQVLILFCTLLCLVFTGTCGIQHLERAGENLSLLTSFYFCIVTFSTVGYGDVTPKIWPS 393 >AB037843-1|BAA92660.1| 1151|Homo sapiens KIAA1422 protein protein. Length = 1151 Score = 29.9 bits (64), Expect = 6.0 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Frame = -3 Query: 431 FNWALFRFCFDLSNQWF-TCSFQHFHHLRKSVSIMDKVIYCTI---SLGHFLHTP*IWTS 264 FN L FC L + TC QH +++S++ +C + ++G+ TP IW S Sbjct: 290 FNQVLILFCTLLCLVFTGTCGIQHLERAGENLSLLTSFYFCIVTFSTVGYGDVTPKIWPS 349 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,201,502 Number of Sequences: 237096 Number of extensions: 1781739 Number of successful extensions: 11114 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11113 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 5273648886 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -