BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060398.seq (661 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0553 - 4123634-4123690,4123756-4124469 29 2.5 11_01_0692 - 5700394-5700474,5700546-5702675,5705033-5706169,570... 28 7.6 03_03_0196 + 15331604-15331646,15332141-15332260,15334106-153342... 28 7.6 >03_01_0553 - 4123634-4123690,4123756-4124469 Length = 256 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 551 LGRLCVRR-HVRLPXGDAXEARIWSRSTRPSXKP 649 L RL +R H+RLP DA R+W + PS KP Sbjct: 48 LARLRIRPVHLRLPGTDATTVRVWCPAA-PSAKP 80 >11_01_0692 - 5700394-5700474,5700546-5702675,5705033-5706169, 5709679-5709975 Length = 1214 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 29 LFSFFVPTRCDVLLNNYSLLHNNPTMPNVKFYYF 130 L S V +CD L + LLH+ P + +K YF Sbjct: 1105 LVSSLVVQQCDSPLREWRLLHHLPALNYLKIQYF 1138 >03_03_0196 + 15331604-15331646,15332141-15332260,15334106-15334221, 15334661-15334749,15334885-15334927,15335567-15335741, 15335840-15335971,15336046-15336383,15336791-15337129, 15337293-15337975,15338228-15338807,15339356-15339679, 15340149-15340262 Length = 1031 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -2 Query: 399 ANVVQELHVLVDLEGLLVIGPGESVL 322 AN + E+H+ + LE LL +GP ++ L Sbjct: 550 ANGINEMHLQIRLEKLLTLGPDDNQL 575 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,011,081 Number of Sequences: 37544 Number of extensions: 267744 Number of successful extensions: 750 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -