BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060398.seq (661 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41680.2 68418.m05065 protein kinase family protein contains ... 29 2.7 At5g41680.1 68418.m05064 protein kinase family protein contains ... 29 2.7 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 29 2.7 At1g68930.1 68414.m07889 pentatricopeptide (PPR) repeat-containi... 29 2.7 At1g51560.1 68414.m05803 expressed protein 28 6.3 >At5g41680.2 68418.m05065 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to receptor-like protein kinase (GI:4008006) [Arabidopsis thaliana]; similar to receptor-like kinase RHG1 (GI:21239380) (GI:21239382) [Glycine max] Length = 333 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -1 Query: 262 APALTERSLRFEFWPVFR*NAIVFELLAAVSQQQPLALAEGLD 134 AP +T+ +F V+ ++ ELL S PL+L E +D Sbjct: 222 APEITDTRKSTQFSDVYSFGVVLLELLTGKSPASPLSLDENMD 264 >At5g41680.1 68418.m05064 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to receptor-like protein kinase (GI:4008006) [Arabidopsis thaliana]; similar to receptor-like kinase RHG1 (GI:21239380) (GI:21239382) [Glycine max] Length = 359 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -1 Query: 262 APALTERSLRFEFWPVFR*NAIVFELLAAVSQQQPLALAEGLD 134 AP +T+ +F V+ ++ ELL S PL+L E +D Sbjct: 248 APEITDTRKSTQFSDVYSFGVVLLELLTGKSPASPLSLDENMD 290 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +3 Query: 174 TAARSSKTIAFHLKTGQNSNLRLRSVRAGAGDRRQAVRPEH 296 TA R+ +T RL + GAG+RRQA PEH Sbjct: 133 TAERNLQTYNGAPMPSSEQAFRLNWAQLGAGERRQAEGPEH 173 >At1g68930.1 68414.m07889 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 743 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 498 TQ*ELTKNNGHIALGKLTWGDFVYAGMYDYL 590 T +L+ +NGH++LGK G + G YL Sbjct: 144 TMLKLSSSNGHVSLGKQIHGQVIKLGFESYL 174 >At1g51560.1 68414.m05803 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +3 Query: 72 TIIHYCTITRQCRTLSSTISPSRPSARARGCCWLTAARSSKTIAFHLKTGQNSNL 236 T ++ C I + T + +P+ P A + CWL +++ + I ++ G N L Sbjct: 7 TSVYVCNIPK---TKKAFFNPN-PPALSSSSCWLCNSQAKQIIKLRIREGSNQGL 57 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,658,766 Number of Sequences: 28952 Number of extensions: 202084 Number of successful extensions: 529 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -