BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060397.seq (658 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 23 6.4 EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 23 8.5 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 23.4 bits (48), Expect = 6.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -3 Query: 230 GWNRSLSSHVIANPSQNLPCQSN 162 GW + + SH PSQ P Q N Sbjct: 522 GWVQPVPSHTQNGPSQPQPQQQN 544 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 23.0 bits (47), Expect = 8.5 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = -2 Query: 381 LVSPLRMLIAFKVLRILSSRGSSN*VQ*FFSSPNRFAISSEGGDRPLED 235 +VSPL + +AF L ++ G+ VQ F P+ + + ++ + D Sbjct: 65 VVSPLAVRLAFSALYQVTDSGTREAVQRAFYLPSAVSDARANAEQLVSD 113 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 630,974 Number of Sequences: 2352 Number of extensions: 11974 Number of successful extensions: 46 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -