BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060396.seq (564 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U67953-3|AAL13328.1| 321|Caenorhabditis elegans Hypothetical pr... 29 3.1 AF016428-6|AAK71396.2| 1733|Caenorhabditis elegans Hypothetical ... 28 4.0 >U67953-3|AAL13328.1| 321|Caenorhabditis elegans Hypothetical protein ZC13.2 protein. Length = 321 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -2 Query: 545 LVRVSFYAGFSLFFLARIRISLFFNVVFNXTHXHQ*RFFQLAELVLISVVV 393 LV + F+ G +FF+ IR + +FN T FQ+A L++ ++ Sbjct: 176 LVIICFWFGSGVFFIFTIRCEVLDTAIFNTTILILVVLFQIAHAGLVTSLI 226 >AF016428-6|AAK71396.2| 1733|Caenorhabditis elegans Hypothetical protein T05C3.2 protein. Length = 1733 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +2 Query: 113 PAKGKKRK-ANTNLVTSEPKNVKQNSLVNADNKNSILD 223 P + KK+K N + + P N Q +V +DNK+S+ D Sbjct: 1535 PRQSKKQKDVMINKIIAMPSNSNQIIVVESDNKSSVWD 1572 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,678,180 Number of Sequences: 27780 Number of extensions: 154234 Number of successful extensions: 366 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 366 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1166125180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -