BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060392.seq (560 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 33 0.005 AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection... 25 1.7 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 24 3.9 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 5.2 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 23 9.0 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 23 9.0 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 23 9.0 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 23 9.0 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 23 9.0 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 23 9.0 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 23 9.0 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 23 9.0 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 23 9.0 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 23 9.0 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 23 9.0 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 23 9.0 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 23 9.0 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 23 9.0 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 23 9.0 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 23 9.0 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 9.0 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 9.0 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 33.5 bits (73), Expect = 0.005 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +1 Query: 169 EYILVEFYAPWCGHCKSLAPE 231 + ++V+F+A WCG CK +AP+ Sbjct: 21 QLVVVDFFATWCGPCKVIAPK 41 Score = 30.3 bits (65), Expect = 0.045 Identities = 16/74 (21%), Positives = 36/74 (48%) Frame = +3 Query: 207 PLQVSGAGIRQGSHKAAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYS 386 P +V + + +K A++ I + KVD + ++LA Y + PT F + + Sbjct: 34 PCKVIAPKLEEFQNKYADK---IVVVKVDVDECEELAAQYNIASMPTFLFIKRKEVVGQF 90 Query: 387 GGRQADDIISWLKK 428 G A+ + +++++ Sbjct: 91 SGANAEKLENFIQQ 104 >AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection responsive shortpeptide protein. Length = 81 Score = 25.0 bits (52), Expect = 1.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 +V YAP C CKS+ Y Sbjct: 21 MVFAYAPTCARCKSIGARY 39 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 23.8 bits (49), Expect = 3.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 216 VSGAGIRQGSHKAAEEESPIKLAKVDATQEQDLAESY 326 VSG G +H AAE + ++ A V +++ E+Y Sbjct: 163 VSGWG---STHNAAESNAILRAANVPTVDQEECREAY 196 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.4 bits (48), Expect = 5.2 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 200 GAATASLWRRNTPRQP 247 G T +LWRRN +P Sbjct: 181 GTRTTTLWRRNNDGEP 196 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 95 IIMFYADWCFACMKAANSF 113 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 95 IIMFYADWCFACMKAANSF 113 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 95 IIMFYADWCFACMKAANSF 113 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 95 IIMFYADWCFACMKAANSF 113 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 95 IIMFYADWCFACMKAANSF 113 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 95 IIMFYADWCFACMKAANSF 113 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 80 IIMFYADWCFACMKAANSF 98 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 80 IIMFYADWCFACMKAANSF 98 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 82 IIMFYADWCFACMKAANSF 100 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 82 IIMFYADWCFACMKAANSF 100 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 85 IIMFYADWCFACMKAANSF 103 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 85 IIMFYADWCFACMKAANSF 103 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 95 IIMFYADWCFACMKAANSF 113 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 95 IIMFYADWCFACMKAANSF 113 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 95 IIMFYADWCFACMKAANSF 113 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 95 IIMFYADWCFACMKAANSF 113 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 95 IIMFYADWCFACMKAANSF 113 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 95 IIMFYADWCFACMKAANSF 113 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 97 IIMFYADWCFACMKAANSF 115 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 97 IIMFYADWCFACMKAANSF 115 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 79 IIMFYADWCFACMKAANSF 97 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 79 IIMFYADWCFACMKAANSF 97 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 178 LVEFYAPWCGHCKSLAPEY 234 ++ FYA WC C A + Sbjct: 94 IIMFYADWCFACMKAANSF 112 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 22.6 bits (46), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 237 QGSHKAAEEESPIKLAKVDA 296 +GSH+ E + P K+ VDA Sbjct: 305 EGSHEEVEMDEPKKILIVDA 324 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 22.6 bits (46), Expect = 9.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 237 QGSHKAAEEESPIKLAKVDA 296 +GSH+ E + P K+ VDA Sbjct: 305 EGSHEEVEMDEPKKILIVDA 324 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 538,224 Number of Sequences: 2352 Number of extensions: 9805 Number of successful extensions: 74 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -