BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060392.seq (560 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 74 8e-14 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 74 8e-14 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 70 9e-13 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 68 4e-12 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 68 4e-12 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 64 6e-11 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 62 3e-10 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 61 6e-10 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 61 6e-10 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 59 2e-09 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 55 3e-08 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 52 3e-07 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 51 6e-07 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 42 2e-04 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 40 0.002 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 39 0.002 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 39 0.002 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 39 0.003 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 38 0.006 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 38 0.006 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 37 0.008 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 37 0.008 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 37 0.008 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 37 0.011 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 36 0.024 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 35 0.032 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 35 0.032 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 35 0.032 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 34 0.057 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 34 0.057 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 34 0.057 At1g34780.1 68414.m04329 protein disulfide isomerase-related con... 33 0.099 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 33 0.13 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 33 0.13 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 33 0.13 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 33 0.17 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 33 0.17 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 33 0.17 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 32 0.23 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 32 0.30 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 32 0.30 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 32 0.30 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 31 0.40 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 31 0.40 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 31 0.40 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 31 0.53 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 31 0.53 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 31 0.53 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 31 0.53 At4g08930.1 68417.m01470 thioredoxin-related contains weak simil... 31 0.70 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 30 0.92 At3g19780.1 68416.m02504 expressed protein 30 0.92 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 30 0.92 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 30 1.2 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 29 1.6 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 29 1.6 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 29 2.1 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 28 3.7 At5g51510.1 68418.m06388 expressed protein 27 6.5 At3g51070.1 68416.m05592 dehydration-responsive protein-related ... 27 6.5 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 27 6.5 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 27 8.6 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 73.7 bits (173), Expect = 8e-14 Identities = 31/67 (46%), Positives = 47/67 (70%) Frame = +3 Query: 261 EESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 440 +E + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP Sbjct: 150 KEDGVVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGP 209 Query: 441 PAVEVTS 461 +T+ Sbjct: 210 GVYNLTT 216 Score = 69.7 bits (163), Expect = 1e-12 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 4/56 (7%) Frame = +1 Query: 79 LGLALGDEVPT----EENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEY 234 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEY Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEY 142 Score = 48.0 bits (109), Expect = 4e-06 Identities = 21/49 (42%), Positives = 33/49 (67%), Gaps = 3/49 (6%) Frame = +1 Query: 97 DEVP--TEENVLVLSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEY 234 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMY 481 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 73.7 bits (173), Expect = 8e-14 Identities = 31/67 (46%), Positives = 47/67 (70%) Frame = +3 Query: 261 EESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 440 +E + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP Sbjct: 150 KEDGVVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGP 209 Query: 441 PAVEVTS 461 +T+ Sbjct: 210 GVYNLTT 216 Score = 69.7 bits (163), Expect = 1e-12 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 4/56 (7%) Frame = +1 Query: 79 LGLALGDEVPT----EENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEY 234 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEY Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEY 142 Score = 48.0 bits (109), Expect = 4e-06 Identities = 21/49 (42%), Positives = 33/49 (67%), Gaps = 3/49 (6%) Frame = +1 Query: 97 DEVP--TEENVLVLSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEY 234 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMY 481 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 70.1 bits (164), Expect = 9e-13 Identities = 37/79 (46%), Positives = 56/79 (70%), Gaps = 8/79 (10%) Frame = +3 Query: 249 KAAEEES----PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQAD 404 KAA E S P+ LAK+DA++E ++ A Y ++G+PTLK RNG S DY+G R+A+ Sbjct: 70 KAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAE 129 Query: 405 DIISWLKKKTGPPAVEVTS 461 I+++LKK++GP +VE+ S Sbjct: 130 GIVTYLKKQSGPASVEIKS 148 Score = 64.9 bits (151), Expect = 3e-11 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = +1 Query: 61 FTAIALLGLALGD--EVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEY 234 F+ + LL L + T+E VL L +NF IS ++I+VEFYAPWCGHC+ LAPEY Sbjct: 9 FSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAPEY 68 Score = 47.6 bits (108), Expect = 6e-06 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +1 Query: 103 VPTEENV---LVLSKANFETVISTTEYILVEFYAPWCGHCKSLAP 228 +P E N +V++++ + V + + +L+EFYAPWCGHC+ LAP Sbjct: 366 IPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAP 410 Score = 40.3 bits (90), Expect = 9e-04 Identities = 17/60 (28%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +3 Query: 258 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKKT 434 + + + +AK+DAT ++++ V+G+PT+ F +G+ + Y G R +D I++++K + Sbjct: 420 QNDPSVIIAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNS 479 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 68.1 bits (159), Expect = 4e-12 Identities = 33/69 (47%), Positives = 42/69 (60%), Gaps = 4/69 (5%) Frame = +1 Query: 40 IAMRVLIFTAIALLGLALG----DEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCG 207 +AMR +I +L L +E T+E VL L NF I+ ++I+VEFYAPWCG Sbjct: 1 MAMRGFTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCG 60 Query: 208 HCKSLAPEY 234 HCK LAPEY Sbjct: 61 HCKQLAPEY 69 Score = 68.1 bits (159), Expect = 4e-12 Identities = 34/98 (34%), Positives = 58/98 (59%), Gaps = 4/98 (4%) Frame = +3 Query: 270 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 437 P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ I+++LKK++G Sbjct: 82 PVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSG 141 Query: 438 PPAVEVTSG*TG*RTYRCQYCYCIGFFSDQSSTRAKNF 551 P + E+ S + +G F S + +F Sbjct: 142 PASAEIKSADDASEVVSDKKVVVVGIFPKLSGSEFDSF 179 Score = 48.4 bits (110), Expect = 3e-06 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = +1 Query: 103 VPTEENV---LVLSKANFETVISTTEYILVEFYAPWCGHCKSLAP 228 +P E N +V+S + + V+++ + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/57 (28%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = +3 Query: 258 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLK 425 + +S + +AK+DAT +++ V+G+PT+ F +G+ + Y G RQ + + +++ Sbjct: 422 QSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRQRESLYLFIR 478 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 68.1 bits (159), Expect = 4e-12 Identities = 33/69 (47%), Positives = 42/69 (60%), Gaps = 4/69 (5%) Frame = +1 Query: 40 IAMRVLIFTAIALLGLALG----DEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCG 207 +AMR +I +L L +E T+E VL L NF I+ ++I+VEFYAPWCG Sbjct: 1 MAMRGFTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCG 60 Query: 208 HCKSLAPEY 234 HCK LAPEY Sbjct: 61 HCKQLAPEY 69 Score = 68.1 bits (159), Expect = 4e-12 Identities = 34/98 (34%), Positives = 58/98 (59%), Gaps = 4/98 (4%) Frame = +3 Query: 270 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 437 P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ I+++LKK++G Sbjct: 82 PVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSG 141 Query: 438 PPAVEVTSG*TG*RTYRCQYCYCIGFFSDQSSTRAKNF 551 P + E+ S + +G F S + +F Sbjct: 142 PASAEIKSADDASEVVSDKKVVVVGIFPKLSGSEFDSF 179 Score = 48.4 bits (110), Expect = 3e-06 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = +1 Query: 103 VPTEENV---LVLSKANFETVISTTEYILVEFYAPWCGHCKSLAP 228 +P E N +V+S + + V+++ + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 41.9 bits (94), Expect = 3e-04 Identities = 19/58 (32%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Frame = +3 Query: 258 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKK 428 + +S + +AK+DAT +++ V+G+PT+ F +G+ + Y G R +D IS++ K Sbjct: 422 QSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDK 479 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 64.1 bits (149), Expect = 6e-11 Identities = 28/95 (29%), Positives = 50/95 (52%) Frame = +3 Query: 267 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 446 S + +AK+D + +A ++G+PTL F NG+ + Y+GG A+DI+ W++KKTG P Sbjct: 128 SSVLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVIWVQKKTGAPI 187 Query: 447 VEVTSG*TG*RTYRCQYCYCIGFFSDQSSTRAKNF 551 + + + R + + +G F + F Sbjct: 188 ITLNTVDEAPRFLDKYHTFVLGLFEKFEGSEHNEF 222 Score = 31.9 bits (69), Expect = 0.30 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 121 VLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEY 234 VL L+ + VI E+++V YAPWC L P + Sbjct: 79 VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRF 116 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 61.7 bits (143), Expect = 3e-10 Identities = 30/71 (42%), Positives = 43/71 (60%), Gaps = 1/71 (1%) Frame = +3 Query: 252 AAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKK 428 A E + LAK+DAT+E DLA+ Y ++G+PT+ F +G Y G R D I++WLKK Sbjct: 142 ATELKGLAALAKIDATEEGDLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKK 201 Query: 429 KTGPPAVEVTS 461 K P +T+ Sbjct: 202 KASPSIHNITT 212 Score = 56.0 bits (129), Expect = 2e-08 Identities = 21/41 (51%), Positives = 29/41 (70%) Frame = +1 Query: 112 EENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEY 234 E++V VL+K NF + + +VEFYAPWCG C++L PEY Sbjct: 98 EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTPEY 138 Score = 45.6 bits (103), Expect = 2e-05 Identities = 26/70 (37%), Positives = 37/70 (52%), Gaps = 3/70 (4%) Frame = +1 Query: 34 DNIAMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANF-ETVISTTEYILVEFYAPWC 204 +NI F A L D +P + +V V+ NF E V+ ++ +L+E YAPWC Sbjct: 408 NNIKTLAEDFLADKLKPFYKSDPLPENNDGDVKVIVGNNFDEIVLDESKDVLLEIYAPWC 467 Query: 205 GHCKSLAPEY 234 GHC+S P Y Sbjct: 468 GHCQSFEPIY 477 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 60.9 bits (141), Expect = 6e-10 Identities = 30/59 (50%), Positives = 38/59 (64%) Frame = +1 Query: 58 IFTAIALLGLALGDEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEY 234 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEY 62 Score = 60.5 bits (140), Expect = 8e-10 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +1 Query: 115 ENVLVLSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEY 234 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTY 181 Score = 59.3 bits (137), Expect = 2e-09 Identities = 27/62 (43%), Positives = 40/62 (64%), Gaps = 2/62 (3%) Frame = +3 Query: 258 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKK 431 ++E + +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K Sbjct: 189 KQEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEK 248 Query: 432 TG 437 +G Sbjct: 249 SG 250 Score = 48.0 bits (109), Expect = 4e-06 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +3 Query: 273 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 437 + +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 60.9 bits (141), Expect = 6e-10 Identities = 30/59 (50%), Positives = 38/59 (64%) Frame = +1 Query: 58 IFTAIALLGLALGDEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEY 234 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEY 62 Score = 60.5 bits (140), Expect = 8e-10 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +1 Query: 115 ENVLVLSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEY 234 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTY 181 Score = 59.3 bits (137), Expect = 2e-09 Identities = 27/62 (43%), Positives = 40/62 (64%), Gaps = 2/62 (3%) Frame = +3 Query: 258 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKK 431 ++E + +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K Sbjct: 189 KQEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEK 248 Query: 432 TG 437 +G Sbjct: 249 SG 250 Score = 48.0 bits (109), Expect = 4e-06 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +3 Query: 273 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 437 + +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 59.3 bits (137), Expect = 2e-09 Identities = 24/45 (53%), Positives = 32/45 (71%) Frame = +1 Query: 97 DEVPTEENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPE 231 D+ + VL L+ +NF++ IST + I V+FYAPWCGHCK L PE Sbjct: 26 DQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPE 70 Score = 49.6 bits (113), Expect = 1e-06 Identities = 23/69 (33%), Positives = 40/69 (57%) Frame = +3 Query: 255 AEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKT 434 A+ + PI +AK++A + LA + +PTL + +G P++Y G R+AD ++ +LKK Sbjct: 79 AKLKQPIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFV 138 Query: 435 GPPAVEVTS 461 P + S Sbjct: 139 APDVAVLES 147 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 55.2 bits (127), Expect = 3e-08 Identities = 21/63 (33%), Positives = 40/63 (63%) Frame = +3 Query: 267 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 446 S + +AK+D + +A ++G+PTL F NG+ Y+GG +++I+ W++KKTG Sbjct: 126 SSVLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVIWVQKKTGAST 185 Query: 447 VEV 455 +++ Sbjct: 186 IKL 188 Score = 34.3 bits (75), Expect = 0.057 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 121 VLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEY 234 V+ L+ N + +I EY++V YAPWC L P + Sbjct: 77 VVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRF 114 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 51.6 bits (118), Expect = 3e-07 Identities = 21/36 (58%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +1 Query: 130 LSKANFET-VISTTEYILVEFYAPWCGHCKSLAPEY 234 L+ +NF+ VI + E +VEF+APWCGHCK LAPE+ Sbjct: 167 LNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEW 202 Score = 49.6 bits (113), Expect = 1e-06 Identities = 19/39 (48%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = +1 Query: 121 VLVLSKANFET-VISTTEYILVEFYAPWCGHCKSLAPEY 234 V+ L+ +NF++ V+++ +LVEF+APWCGHCK+L P + Sbjct: 32 VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTW 70 Score = 49.6 bits (113), Expect = 1e-06 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +3 Query: 279 LAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKK 431 +A +DA Q A+ YG++G+PT+K F G +PIDY G R A I ++ K+ Sbjct: 83 VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQ 134 Score = 35.9 bits (79), Expect = 0.019 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = +3 Query: 264 ESPIKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKK--K 431 + +KL V+ EQ + + V+G+PT+ F SP Y G R A I S+ + + Sbjct: 210 QGKVKLGHVNCDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVE 269 Query: 432 TGPPAVEVT 458 + VEVT Sbjct: 270 SSAGPVEVT 278 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 50.8 bits (116), Expect = 6e-07 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +1 Query: 130 LSKANF-ETVISTTEYILVEFYAPWCGHCKSLAPEY 234 L+ +NF E V + E +VEF+APWCGHCK LAPE+ Sbjct: 168 LNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEW 203 Score = 50.4 bits (115), Expect = 8e-07 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = +1 Query: 121 VLVLSKANFET-VISTTEYILVEFYAPWCGHCKSLAPEY 234 VL L+ +NF++ V+++ +LVEF+APWCGHC+SL P + Sbjct: 30 VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTW 68 Score = 47.6 bits (108), Expect = 6e-06 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +3 Query: 279 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKK 431 +A +DA + +++ YGVRG+PT+K F G PIDY G R A I + K+ Sbjct: 81 VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQ 132 Score = 39.9 bits (89), Expect = 0.001 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 7/79 (8%) Frame = +3 Query: 249 KAAEE-ESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRN--GSPIDYSGGRQADDIISW 419 KAA + +KL V+ EQ + + V+G+PT+ F + SP+ Y G R A I S+ Sbjct: 205 KAANNLKGKVKLGHVNCDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESF 264 Query: 420 ----LKKKTGPPAVEVTSG 464 L+ GP V +G Sbjct: 265 ALEQLESNAGPAEVTELTG 283 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +3 Query: 258 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 377 E + + LAKVD TQE DL ++GYP+++ FR GS + Sbjct: 194 EMDGRVILAKVDCTQEGDLCRRNHIQGYPSIRIFRKGSDL 233 Score = 39.1 bits (87), Expect = 0.002 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +1 Query: 94 GDEVPTE--ENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEY 234 GDE E E+ + L+ NF+T ++V FYAPWC C L P + Sbjct: 132 GDETGEEIVEDSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKPSW 180 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 39.5 bits (88), Expect = 0.002 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +1 Query: 37 NIAMRVLIFTAIALLGLALGDEVPTEENV--LVLSKANFETVISTTEYILVEFYAPWCGH 210 +I RV T IA L L + + ++ L S +E +S + +VEFYA WC Sbjct: 93 DINRRVAAVTVIAALSLFVSTRLDFGISLKDLTASALPYEEALSNGKPTVVEFYADWCEV 152 Query: 211 CKSLAPE 231 C+ LAP+ Sbjct: 153 CRELAPD 159 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = +1 Query: 112 EENVLVLSKANFETVI--STTEYILVEFYAPWCGHCKSLAPEY 234 ++N + L+ NF++V S +Y ++EF+A WC C++ P Y Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHY 82 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = +1 Query: 112 EENVLVLSKANFETVI--STTEYILVEFYAPWCGHCKSLAPEY 234 ++N + L+ NF++V S +Y ++EF+A WC C++ P Y Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHY 82 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 38.7 bits (86), Expect = 0.003 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = +1 Query: 112 EENVLVLSKANFETVISTT--EYILVEFYAPWCGHCKSLAPEY 234 ++ + L+ NF++V+ T +Y +VEF+A WC C++ P Y Sbjct: 34 KDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHY 76 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 37.5 bits (83), Expect = 0.006 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +1 Query: 109 TEENVLVLSKANFET-VISTTEYILVEFYAPWCGHCKSLAP 228 T ++ V++ + +++ V+ T ++V+F+APWCG CK + P Sbjct: 78 TTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 37.5 bits (83), Expect = 0.006 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 10/90 (11%) Frame = +3 Query: 201 VRPLQVSGAGIRQGSHKAAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI- 377 ++P V + I + + ++ + L VD T+E L +S ++GYP+++ FR GS + Sbjct: 177 LKPSWVKASQITRERYNPGTDDR-VLLGSVDCTEEPTLCKSNHIQGYPSIRIFRRGSGLR 235 Query: 378 ---------DYSGGRQADDIISWLKKKTGP 440 Y G R D ++ +++ P Sbjct: 236 EDHGNHEHESYYGDRDTDSLVKMVEELLKP 265 Score = 30.3 bits (65), Expect = 0.92 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 130 LSKANFETVISTTEYILVEFYAPWCGHCKSLAPEY 234 L+ A FE + ++V FYAPWC L P + Sbjct: 147 LTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPSW 181 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 37.1 bits (82), Expect = 0.008 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 10/71 (14%) Frame = +3 Query: 258 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADD 407 E + + L VD T+E L + ++GYP+++ FR GS + Y G R D Sbjct: 194 EADGRVLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDS 253 Query: 408 IISWLKKKTGP 440 I+ ++ P Sbjct: 254 IVKMVEGLVAP 264 Score = 32.3 bits (70), Expect = 0.23 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +1 Query: 64 TAIALLGLALGDEVPTE--ENVLVLSKANFETVISTTEYILVEFYAPWCGHCKSLAPEY 234 + +AL + G+E E + + L+ A+FE + ++V F APWC L P + Sbjct: 122 SGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSW 180 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/34 (44%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +1 Query: 130 LSKANFET-VISTTEYILVEFYAPWCGHCKSLAP 228 LS + ++T V+ + +LVEF+APWCG C+ + P Sbjct: 91 LSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHP 124 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +3 Query: 276 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 380 K K++ + + A YG+R PT+ F+ G D Sbjct: 138 KFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKD 172 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 37.1 bits (82), Expect = 0.008 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +3 Query: 285 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 437 KVD + Q +A+ +GV PT F + G +D G +D+ + + K TG Sbjct: 65 KVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTG 115 Score = 27.1 bits (57), Expect = 8.6 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +1 Query: 163 TTEYILVEFYAPWCGHCKSLAP 228 + + I+++F A WC C+ +AP Sbjct: 27 SNKLIVIDFTASWCPPCRMIAP 48 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 36.7 bits (81), Expect = 0.011 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +1 Query: 109 TEENVLVLSKANFET-VISTTEYILVEFYAPWCGHCKSLAP 228 T + V++ + +++ V+ E + V+F+APWCG CK + P Sbjct: 72 TATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDP 112 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +3 Query: 276 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 416 K K++ + YGVR PT+ F NG D G + D ++ Sbjct: 126 KFYKLNTDESPATPGQYGVRSIPTIMIFVNGEKKDTIIGAVSKDTLA 172 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 35.5 bits (78), Expect = 0.024 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 151 TVISTTEYILVEFYAPWCGHCKSLAP 228 TV+ + + +LVEF A WCG CK + P Sbjct: 82 TVLESAQPVLVEFVATWCGPCKLIYP 107 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 35.1 bits (77), Expect = 0.032 Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Frame = +1 Query: 100 EVPTEENVLVLSKANF--ETVISTTEYILV-EFYAPWCGHCKSLAPE 231 E T N+L + AN +++++ + ++V +FY+P CG CKSL P+ Sbjct: 80 EKSTNHNMLEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPK 126 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 35.1 bits (77), Expect = 0.032 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 136 KANFETVISTTEYILVEFYAPWCGHCKSLAPE 231 K+ + T + +++EF A WCG CK+L P+ Sbjct: 49 KSRLNALKDTNKLLVIEFTAKWCGPCKTLEPK 80 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 35.1 bits (77), Expect = 0.032 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +1 Query: 100 EVPTEENVLVLSKANFETVI---STTEYILVEFYAPWCGHCKSLAPEY 234 E+ NV+ LSK E ++ + E LV YAPWC C+++ Y Sbjct: 337 EIFESNNVVALSKGGVENLLKLENRKEAWLVVLYAPWCPFCQAMEASY 384 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 34.3 bits (75), Expect = 0.057 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +3 Query: 249 KAAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK 425 KA E + I++ +VD + + + YPT F NG + Y G R + + +++ Sbjct: 70 KAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVV 129 Query: 426 KKT 434 ++T Sbjct: 130 EET 132 Score = 29.1 bits (62), Expect = 2.1 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 121 VLVLSKANFETVISTTEYI-LVEFYAPWCGHCKSL 222 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 34.3 bits (75), Expect = 0.057 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +3 Query: 249 KAAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK 425 KA E + I++ +VD + + + YPT F NG + Y G R + + +++ Sbjct: 70 KAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVV 129 Query: 426 KKT 434 ++T Sbjct: 130 EET 132 Score = 29.1 bits (62), Expect = 2.1 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 121 VLVLSKANFETVISTTEYI-LVEFYAPWCGHCKSL 222 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 34.3 bits (75), Expect = 0.057 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +3 Query: 249 KAAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK 425 KA E + I++ +VD + + + YPT F NG + Y G R + + +++ Sbjct: 70 KAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVV 129 Query: 426 KKT 434 ++T Sbjct: 130 EET 132 Score = 29.1 bits (62), Expect = 2.1 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 121 VLVLSKANFETVISTTEYI-LVEFYAPWCGHCKSL 222 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g34780.1 68414.m04329 protein disulfide isomerase-related contains weak similarity to Pfam:P08003 protein disulfide isomerase A4 precursor (Protein ERp-72, ERp72) [Mus musculus] Length = 310 Score = 33.5 bits (73), Expect = 0.099 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +3 Query: 324 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTS 461 YGV G+PTL + Y G R D ++++ TG ++ TS Sbjct: 131 YGVHGFPTLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIETLDKTS 176 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 33.1 bits (72), Expect = 0.13 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 255 AEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 380 A + S + KVD + D+A S+ + PT F R+G +D Sbjct: 318 ATQHSRVVFLKVDIDKANDVAASWNISSVPTFCFIRDGKEVD 359 Score = 27.5 bits (58), Expect = 6.5 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = +1 Query: 136 KANFETVISTTEYILVEFYAPWCGHCKSLAPEY 234 +A + + +++ F A WCG C+ ++P Y Sbjct: 282 EAKTKAAKKASRLLILYFTATWCGPCRYMSPLY 314 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 33.1 bits (72), Expect = 0.13 Identities = 10/31 (32%), Positives = 22/31 (70%) Frame = +1 Query: 136 KANFETVISTTEYILVEFYAPWCGHCKSLAP 228 K+ F+++ + + ++++F A WCG CK++ P Sbjct: 33 KSLFDSMKGSNKLLVIDFTAVWCGPCKAMEP 63 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 33.1 bits (72), Expect = 0.13 Identities = 18/61 (29%), Positives = 30/61 (49%) Frame = +3 Query: 255 AEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKT 434 A++ + + K+D + Q +A+ + V PT F + G+ ID G D+I L K Sbjct: 53 AKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKHG 112 Query: 435 G 437 G Sbjct: 113 G 113 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 32.7 bits (71), Expect = 0.17 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +1 Query: 109 TEENVLVLSKANFETVISTT--EYILVEFYAPWCGHCKSLAPEY 234 T V + K F ++ + ++++ Y WCG CK +AP+Y Sbjct: 76 TVGQVTEVDKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKY 119 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/55 (23%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 255 AEEESPIKLAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 416 +E+ + K+D Q+ + LA+ G+R PT K ++ + G + +D+++ Sbjct: 123 SEKYQDMVFLKLDCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLA 177 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 32.7 bits (71), Expect = 0.17 Identities = 9/27 (33%), Positives = 20/27 (74%) Frame = +1 Query: 148 ETVISTTEYILVEFYAPWCGHCKSLAP 228 + ++++ + +LV++YA WCG C+ + P Sbjct: 75 DLLVNSDKPVLVDYYATWCGPCQFMVP 101 Score = 32.3 bits (70), Expect = 0.23 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 273 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 413 I++ K+D + +A Y + PT F++G P D + G A +I Sbjct: 114 IQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGALTAKQLI 161 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 32.7 bits (71), Expect = 0.17 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +1 Query: 142 NFETVISTTEY-ILVEFYAPWCGHCKSLAP 228 +F+ ++ ++ +LV+FYA WCG C+ + P Sbjct: 67 SFDDLLQNSDKPVLVDFYATWCGPCQLMVP 96 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 273 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 413 I + K+D + LA Y + PT F++G D + G A+ ++ Sbjct: 109 IAVVKIDTEKYPSLANKYQIEALPTFILFKDGKLWDRFEGALPANQLV 156 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 32.3 bits (70), Expect = 0.23 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 175 ILVEFYAPWCGHCKSLAPEY 234 ++++ Y WCG CK +AP+Y Sbjct: 90 VVLDMYTQWCGPCKVIAPKY 109 Score = 28.3 bits (60), Expect = 3.7 Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +3 Query: 255 AEEESPIKLAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 416 +E+ + K+D + + LA+ G+R PT K ++ + G + DD+++ Sbjct: 113 SEKYDDVVFLKLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVA 167 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 31.9 bits (69), Expect = 0.30 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +1 Query: 82 GLALGDEVPTEENVLVLSKANFETVI---STTEYILVEFYAPWCGHCKSLAPEY 234 G A ++ ENV+ LS+ E ++ + E +V YAPWC C+++ + Sbjct: 335 GTASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAMEASF 388 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 31.9 bits (69), Expect = 0.30 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +3 Query: 285 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 437 +V+A + +++E+Y V P FF++G +D G + + + K G Sbjct: 57 RVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTLEGADPSSLANKVGKVAG 107 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 31.9 bits (69), Expect = 0.30 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +1 Query: 115 ENVLVLSKANFETVI---STTEYILVEFYAPWCGHCKSLAPEY 234 EN++ LS+ E ++ + E +V YAPWC C+++ Y Sbjct: 353 ENLVTLSRQGIENLMKLENRKEPWIVVLYAPWCPFCQAMEASY 395 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 31.5 bits (68), Expect = 0.40 Identities = 14/60 (23%), Positives = 28/60 (46%) Frame = +3 Query: 231 IRQGSHKAAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 410 I H A++ + + K+D + D+A+ + V PT + G I+ G + D++ Sbjct: 65 IEPAIHAMADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDEL 124 Score = 30.3 bits (65), Expect = 0.92 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +1 Query: 142 NFETVISTTEYILVEFYAPWCGHCKSLAP 228 +F + + + ++V+F A WCG C+ + P Sbjct: 39 HFNEIKESNKLLVVDFSASWCGPCRMIEP 67 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 31.5 bits (68), Expect = 0.40 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = +1 Query: 175 ILVEFYAPWCGHCKSLAPE 231 ++V+FY WCG C+++ P+ Sbjct: 116 VIVDFYGTWCGSCRAMFPK 134 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 31.5 bits (68), Expect = 0.40 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 148 ETVISTTEYILVEFYAPWCGHCK 216 ++V+ + +LVEFY WCG C+ Sbjct: 78 DSVLKSETPVLVEFYTSWCGPCR 100 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 31.1 bits (67), Expect = 0.53 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 Query: 175 ILVEFYAPWCGHCKSLAPE 231 ++VEFY WC C++L P+ Sbjct: 126 VIVEFYGTWCASCRALFPK 144 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 31.1 bits (67), Expect = 0.53 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 Query: 175 ILVEFYAPWCGHCKSLAPE 231 ++VEFY WC C++L P+ Sbjct: 126 VIVEFYGTWCASCRALFPK 144 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 31.1 bits (67), Expect = 0.53 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +3 Query: 285 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 428 KVD + + +A + ++ PT F + G +D G + D++ S + K Sbjct: 64 KVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAK 111 Score = 29.5 bits (63), Expect = 1.6 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +1 Query: 175 ILVEFYAPWCGHCKSLAP 228 ++V+F A WCG C+ +AP Sbjct: 31 VVVDFTASWCGPCRFIAP 48 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 31.1 bits (67), Expect = 0.53 Identities = 18/41 (43%), Positives = 21/41 (51%) Frame = +3 Query: 252 AAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSP 374 A E ES + KVD E + A VRG PTL FF + P Sbjct: 120 AVEYESNAIIVKVDTDDEYEFARDMQVRGLPTL-FFISPDP 159 Score = 29.9 bits (64), Expect = 1.2 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 175 ILVEFYAPWCGHCKSLAPE 231 ++V+FYA WCG C +A E Sbjct: 97 LIVDFYATWCGPCILMAQE 115 >At4g08930.1 68417.m01470 thioredoxin-related contains weak similarity to Swiss-Prot:Q39239 thioredoxin H-type 4 (TRX-H-4). [Mouse-ear cress] Length = 295 Score = 30.7 bits (66), Expect = 0.70 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 324 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 437 YGV G+PT+ + + Y G R D ++++ TG Sbjct: 124 YGVHGFPTIILMNSTMLVVYRGSRTLDSLVAFYTDVTG 161 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 30.3 bits (65), Expect = 0.92 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +3 Query: 285 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 437 +V+A + +++E+Y V P FF++G +D G + + + K G Sbjct: 57 RVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEGADPSSLANKVGKVAG 107 >At3g19780.1 68416.m02504 expressed protein Length = 1014 Score = 30.3 bits (65), Expect = 0.92 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 127 VLSKANFETVISTTEYILVEFYAPWCGHCKSLAPE 231 +L++ NF + I ++L+ PWCG +SL E Sbjct: 29 ILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKYE 63 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 30.3 bits (65), Expect = 0.92 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 160 STTEYILVEFYAPWCGHCKSLAP 228 S T +++V F A WCG C+ + P Sbjct: 225 SQTPHVMVMFTARWCGPCRDMIP 247 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 29.9 bits (64), Expect = 1.2 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 4/44 (9%) Frame = +1 Query: 112 EENVLVLSKANFETVISTT----EYILVEFYAPWCGHCKSLAPE 231 ++N+ +S A E V S T + ++V+F++P CG CK+L P+ Sbjct: 96 KDNMREISSAQ-ELVDSLTNAGDKLVVVDFFSPGCGGCKALHPK 138 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +3 Query: 255 AEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 428 A++ + KVD + +AE + V+ PT F + G + G ++II+ L+K Sbjct: 53 AKKHLDVVFFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEK 110 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +3 Query: 255 AEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 377 +E+ S + VD + D + S+ ++ PT F +NG I Sbjct: 71 SEKHSSLMFLLVDVDELSDFSSSWDIKATPTFFFLKNGQQI 111 Score = 27.9 bits (59), Expect = 4.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 175 ILVEFYAPWCGHCKSLAP 228 ++ F A WCG CK +AP Sbjct: 48 VVANFSATWCGPCKIVAP 65 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 29.1 bits (62), Expect = 2.1 Identities = 9/19 (47%), Positives = 16/19 (84%) Frame = +1 Query: 175 ILVEFYAPWCGHCKSLAPE 231 ++V+F++P CG CK+L P+ Sbjct: 116 VVVDFFSPSCGGCKALHPK 134 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 28.3 bits (60), Expect = 3.7 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 288 VDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 410 VD + +++A V+ PT F ++G+ +D G D+I Sbjct: 61 VDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEI 101 >At5g51510.1 68418.m06388 expressed protein Length = 170 Score = 27.5 bits (58), Expect = 6.5 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = -1 Query: 521 RKETNTITVLASISSLACSARGNLNSRGASLLLQPTDDVISLTTT*IVNRTAIPEEL--E 348 + E NT+ + A+++ L CS G L R + + L S + A+ L E Sbjct: 64 KDEKNTLAIAAAVAGLVCSLIGELGCRRSRVNLLRLYTAASTIVMVLSVFCAVRSRLTME 123 Query: 347 SRVSSHTVALGEILFLSC 294 R SS T A E+ C Sbjct: 124 ERNSSGTTAKLELAGFIC 141 >At3g51070.1 68416.m05592 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 895 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/56 (25%), Positives = 27/56 (48%) Frame = +3 Query: 231 IRQGSHKAAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQ 398 + QG+ + E++S + DAT+++ E+ T K NG P + + G + Sbjct: 196 VEQGNKQGQEQDSNTDVTFTDATKQEQPMETGQGETSETSKNEENGQPEEQNSGNE 251 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 27.5 bits (58), Expect = 6.5 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 288 VDATQEQDLAESYGVRGYPTLKFFRNGSPI 377 VD + LA++ +R PT K ++NG + Sbjct: 642 VDVEESMALAKAESIRKVPTFKMYKNGDKV 671 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 273 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 377 I KVD + + + VR PT+K ++NGS + Sbjct: 645 IHFLKVDIDKCPSIGNAENVRVVPTVKIYKNGSRV 679 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,528,661 Number of Sequences: 28952 Number of extensions: 219471 Number of successful extensions: 700 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 690 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1072696904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -