BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060391.seq (573 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 27 0.57 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 24 4.0 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 23 5.3 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 5.3 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 26.6 bits (56), Expect = 0.57 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +1 Query: 397 TCRQEGCTCWNSAQRSAFSYWTFCFQFVPVTPHSSALL--IGTSTRISLGNF 546 TC G C + + + TF ++ VP++P SA+ + ++ +IS+ NF Sbjct: 93 TCALNGEYCLTHMECCSGNCLTFSYKCVPLSPSDSAMTGPLYSTPQISMVNF 144 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 23.8 bits (49), Expect = 4.0 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +2 Query: 332 KHVR--RIRPNLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 463 KHV+ + +LK +VC+ + +RVV GI SGL L +GP Sbjct: 109 KHVKFCQFAFDLKCDSVCV---NPYHYERVVSPGIDLSGLTLQSGP 151 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 23.4 bits (48), Expect = 5.3 Identities = 8/24 (33%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +1 Query: 421 CWNSAQRSAFSYWTFCFQF-VPVT 489 CW+ A++ + W+F F +P+T Sbjct: 337 CWSRARKLVAAAWSFSILFSLPIT 360 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 5.3 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -1 Query: 489 RNGHELKAKGPVTKSRPLGRIPTSTTLLPACL--PARR 382 +N H K P ++ P R P S P+C PARR Sbjct: 241 KNAHASIRKIPPSRRNPRRRSPRSGGRWPSCRSPPARR 278 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 600,808 Number of Sequences: 2352 Number of extensions: 12583 Number of successful extensions: 31 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -