BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060391.seq (573 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 23 2.1 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 5.0 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 5.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 5.0 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 6.6 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 8.7 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 23.0 bits (47), Expect = 2.1 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +2 Query: 236 EWGNQNIPLKRRKSFYP 286 EW +P +R K +YP Sbjct: 200 EWDILGVPAERHKKYYP 216 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 304 TDFLLSGVEGLPTFEGYVLVPPFFSPPICFTT 209 T FL++ E LP E L+ ++ IC T Sbjct: 256 TVFLMTIRESLPPTEKTPLISLYYGVSICLVT 287 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 499 SALLIGTSTRISLGNFKLPKHFND 570 +ALLI ST ++ K+P++FN+ Sbjct: 681 NALLILISTVYAVKTRKIPENFNE 704 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 499 SALLIGTSTRISLGNFKLPKHFND 570 +ALLI ST ++ K+P++FN+ Sbjct: 771 NALLILISTVYAVKTRKIPENFNE 794 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = +1 Query: 280 LPHSGENPCLIWWPSIQQACTQDPTQ 357 +P +NP + W AC+ P Q Sbjct: 373 IPEPSKNPAMGHWQMSCVACSPPPRQ 398 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.0 bits (42), Expect = 8.7 Identities = 6/17 (35%), Positives = 9/17 (52%) Frame = +2 Query: 236 EWGNQNIPLKRRKSFYP 286 EW +P R + +YP Sbjct: 214 EWDILEVPASRNEEYYP 230 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,800 Number of Sequences: 438 Number of extensions: 3488 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16504155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -