BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060389.seq (569 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 29 0.11 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 0.99 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 25 1.3 AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-tran... 24 4.0 AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-tran... 24 4.0 AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein ... 24 4.0 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 5.3 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 23 5.3 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 7.0 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 23 7.0 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 7.0 AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-tran... 23 7.0 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 9.3 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 23 9.3 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 29.1 bits (62), Expect = 0.11 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +2 Query: 92 DGQEAEYPQHVCDRPRRSRQVNPHGLVGFQGRYHCWCESRR 214 D A QH+ RP+RS + NP GR H C+SRR Sbjct: 273 DENPAGAQQHLSHRPQRSTRKNP------AGRQHDRCDSRR 307 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.8 bits (54), Expect = 0.99 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -3 Query: 378 SIKLIKKPFSLFSRWSGFVMNTKSFSSSSKNIEMAVDL 265 +++L+KKP SL S W + N ++A+ L Sbjct: 156 TVRLLKKPPSLDSEWKSSTSTIQLIEQLDSNKQLAIAL 193 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.4 bits (53), Expect = 1.3 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 171 LVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSL 284 +V + G++ G ET RK+ +R+ PL R L Sbjct: 804 MVLQEGVVEGGTKDETDMERERKEMVERSRPLRKRKRL 841 >AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-transferase 3-8 protein. Length = 225 Score = 23.8 bits (49), Expect = 4.0 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +2 Query: 242 RTRPCITIKSTAISMFFELEEKDLVFI 322 ++ PC +K TA ++ EL EK++ + Sbjct: 13 KSPPCRAVKLTARALGIELVEKEMTLL 39 >AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-transferase E7 protein. Length = 225 Score = 23.8 bits (49), Expect = 4.0 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +2 Query: 242 RTRPCITIKSTAISMFFELEEKDLVFI 322 ++ PC +K TA ++ EL EK++ + Sbjct: 13 KSPPCRAVKLTARALGIELVEKEMTLL 39 >AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein L8 protein. Length = 261 Score = 23.8 bits (49), Expect = 4.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 486 SVCTHTPDTQSTTTRAPS 433 SV H PDT+ T + PS Sbjct: 135 SVIAHNPDTKRTRVKLPS 152 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 5.3 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 107 EYPQHVCDRPRRSRQVNPHGLVGFQG 184 ++P HVC+R R+ +N +V G Sbjct: 350 QHPLHVCERFERASVINREEIVRKHG 375 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 23.4 bits (48), Expect = 5.3 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 495 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKST-CPGES 376 +TV+ T T +TTT AP+ T + A +T PG++ Sbjct: 34 TTVAPTTTTVAPTTTTTVAPTTTTTVAPGQTTTTTVAPGQT 74 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 7.0 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 480 CTHTPDTQSTTTRAPSVTRSAAVTS 406 CT++ D+ +TTT S + S+ T+ Sbjct: 471 CTYSSDSTTTTTTTKSASTSSHSTT 495 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 23.0 bits (47), Expect = 7.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 462 CLVCVYKPKQYCVRLFRA 515 C+VC + Q CVRL +A Sbjct: 354 CVVCDFTCHQQCVRLEKA 371 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.0 bits (47), Expect = 7.0 Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 5/31 (16%) Frame = +1 Query: 460 CVWCVCTNRNSTASGYSER-----IKPILFM 537 C WC CT + A Y+++ ++P+ F+ Sbjct: 366 CRWCECTLGDLIADAYADQYTNSTVQPVAFV 396 >AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-transferase E2 protein. Length = 221 Score = 23.0 bits (47), Expect = 7.0 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 251 PCITIKSTAISMFFELEEKDLVFIT 325 PC ++ TA ++ ELE+K + +T Sbjct: 14 PCRAVELTAKALGLELEQKTINLLT 38 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 22.6 bits (46), Expect = 9.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 465 LVCVYKPKQYCVRLFRAHQAYSVHEQNGPCSS 560 + C YKPKQ+ +R A++ + H+ G S+ Sbjct: 1609 MACNYKPKQHSMRSDEANK--NGHDSAGVLST 1638 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 22.6 bits (46), Expect = 9.3 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +2 Query: 80 DPWDDGQEAEYPQHVCDRPRRSRQVNP 160 D WDD + E+ + D P + P Sbjct: 248 DDWDDEMDGEWEPPMIDNPEYKGEWKP 274 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 603,508 Number of Sequences: 2352 Number of extensions: 11863 Number of successful extensions: 30 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -