BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060388.seq (557 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 59 3e-09 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 55 3e-08 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 50 1e-06 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 50 1e-06 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 47 1e-05 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 42 3e-04 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 33 0.16 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 32 0.37 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 31 0.64 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 31 0.64 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 30 1.1 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 30 1.5 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 29 3.4 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 5.9 SB_42409| Best HMM Match : Pkinase (HMM E-Value=6.7e-24) 27 7.9 SB_30516| Best HMM Match : GETHR (HMM E-Value=0.9) 27 7.9 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 58.8 bits (136), Expect = 3e-09 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = +2 Query: 254 NEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 412 +EV+ YR + ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 60 HEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 55.2 bits (127), Expect = 3e-08 Identities = 22/62 (35%), Positives = 39/62 (62%) Frame = +2 Query: 269 YRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQXWPIAMSGKNLV 448 +R + ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + ++++ Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDII 142 Query: 449 GV 454 GV Sbjct: 143 GV 144 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 50.4 bits (115), Expect = 1e-06 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 4/80 (5%) Frame = +2 Query: 257 EVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQXWPIAMSG 436 E+++ R + VSG P F F + + ++ + Y +PT IQ Q PIA+SG Sbjct: 495 EIDDLRKKMGIKVSGAMPARPCISFAHFGFDEQMMASIRKLEYTQPTQIQCQALPIALSG 554 Query: 437 KNLVGVLK----RVPAKRWP 484 ++++G+ K + A WP Sbjct: 555 RDIIGIAKTGSGKTAAFLWP 574 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +1 Query: 457 QTGSGKTLAYILPAIVH 507 +TGSGKT A++ PA+VH Sbjct: 562 KTGSGKTAAFLWPALVH 578 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 50.0 bits (114), Expect = 1e-06 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 4/75 (5%) Frame = +2 Query: 239 SQKITNEVEEYRNNHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQ 406 ++K ++ +R+ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Sbjct: 131 AEKHQEKINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQ 190 Query: 407 AQXWPIAMSGKNLVG 451 Q P+ G G Sbjct: 191 MQATPLMAHGPKKSG 205 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 50.0 bits (114), Expect = 1e-06 Identities = 23/78 (29%), Positives = 42/78 (53%) Frame = +2 Query: 257 EVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQXWPIAMSG 436 +V++ R+ E+ V G V +P+ F +F + + + + GY PTPIQ Q P+ +SG Sbjct: 174 QVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPTPIQMQVLPVLLSG 233 Query: 437 KNLVGVLKRVPAKRWPTS 490 ++++ K P+S Sbjct: 234 RDVMVCASTGSGKLLPSS 251 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 46.8 bits (106), Expect = 1e-05 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 3/90 (3%) Frame = +2 Query: 260 VEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQXWPIAMSGK 439 V+E R + + + G + PI+ F + N P + + ++ PTPIQ Q MSG+ Sbjct: 51 VDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKNFQVPTPIQMQSLSCVMSGR 110 Query: 440 NLVGVLKRVPAKRWPTS---CQPLCTKQPT 520 +++G+ + K S C L TK P+ Sbjct: 111 DIIGLAETGSGKTLAYSLPLCMLLRTKAPS 140 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/68 (29%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = +2 Query: 257 EVEEYRNNHE-VTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQXWPIAMS 433 E +E+R + E + V G P++ + + + +K Y++PTPIQAQ P+ MS Sbjct: 82 ETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILDVLKKNSYEKPTPIQAQAIPVIMS 141 Query: 434 GKNLVGVL 457 G++++ ++ Sbjct: 142 GRDMIAIV 149 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 41.9 bits (94), Expect = 3e-04 Identities = 21/55 (38%), Positives = 31/55 (56%) Frame = +2 Query: 284 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQXWPIAMSGKNLV 448 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++++ Sbjct: 698 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVM 752 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 41.9 bits (94), Expect = 3e-04 Identities = 21/55 (38%), Positives = 31/55 (56%) Frame = +2 Query: 284 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQXWPIAMSGKNLV 448 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++++ Sbjct: 121 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVM 175 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +2 Query: 293 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQXWPIAMSGKNLV 448 VSG I F E F + + + GY+ PTP+Q PI M+G++L+ Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLM 520 Score = 28.3 bits (60), Expect = 4.5 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 457 QTGSGKTLAYILPAI 501 QTGSGKT AY+LP + Sbjct: 524 QTGSGKTAAYMLPVL 538 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 33.1 bits (72), Expect = 0.16 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +2 Query: 320 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQXWPIAMSGKNLVGVLK 460 ++ F + G+ G+ PT IQ Q P+A+SG++++G K Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAK 95 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 31.9 bits (69), Expect = 0.37 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 362 QGVKTMGYKEPTPIQAQXWPIAMSGKNL 445 + V +G+ PTPIQA P+A+ GK++ Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDV 50 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 31.9 bits (69), Expect = 0.37 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 Query: 320 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQXWPIAMSGKNLV 448 I FE+ + + + V GYK+PTP+Q PI ++L+ Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLM 916 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 31.1 bits (67), Expect = 0.64 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +2 Query: 305 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQXW 418 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 31.1 bits (67), Expect = 0.64 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = +2 Query: 329 FEEANFPDYVQQGVKTMGYKEPTPIQAQXWPIAMSGKNLVGVLKRVPAK 475 FE+ + G+ G+ +P+PIQ + P+A++G++++ K K Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 31.1 bits (67), Expect = 0.64 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = +2 Query: 329 FEEANFPDYVQQGVKTMGYKEPTPIQAQXWPIAMSGKNLVGVLKRVPAK 475 FE+ + G+ G+ +P+PIQ + P+A++G++++ K K Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +2 Query: 248 ITNEVEEYRNN--HEVTVSGVEVHNPIQYFEEANFPDY 355 I E EE NN H++ + + +HNP YFE+ + DY Sbjct: 228 IEQEAEEEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 29.9 bits (64), Expect = 1.5 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +1 Query: 457 QTGSGKTLAYILPAIVHK 510 QTGSGKTLAY+ P +VH+ Sbjct: 423 QTGSGKTLAYLAP-LVHR 439 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 28.7 bits (61), Expect = 3.4 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +2 Query: 281 HEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQXWPIAMS 433 HEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 86 HEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLA 139 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 177 CQIETNYRRICCLLQIWN-HRFHGYYSS 97 C + +YRR CC L +W H + Y+SS Sbjct: 218 CCVRVDYRRKCC-LHVWRVHTTNTYWSS 244 >SB_42409| Best HMM Match : Pkinase (HMM E-Value=6.7e-24) Length = 465 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -3 Query: 540 HHLSE*AVGCFVHNGWQDVGQRFAGTRLSTPTKFFP 433 ++ +E ++ FV+N WQ GQ+F + ST T+ P Sbjct: 59 NNANEPSIAGFVYN-WQSAGQKFEFIKNSTNTRQLP 93 >SB_30516| Best HMM Match : GETHR (HMM E-Value=0.9) Length = 1058 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +2 Query: 404 QAQXWPIAMSGKNLVGVLKRVPAKRWPTSCQPLCTKQPTAYSER 535 +A+ +P GK V KR AKR+P + + + PT E+ Sbjct: 601 RAKRYPNTKRGKAEVSYTKRGKAKRYPNTKRGKAKRSPTLNEEK 644 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +1 Query: 457 QTGSGKTLAYILPAIVH 507 +TGSGKTLA+ +P I H Sbjct: 176 ETGSGKTLAFGIPIIQH 192 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,436,971 Number of Sequences: 59808 Number of extensions: 281266 Number of successful extensions: 785 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1300738331 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -