BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060387.seq (656 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40594| Best HMM Match : Extensin_2 (HMM E-Value=0.083) 107 6e-24 SB_56313| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-14) 35 0.051 SB_50411| Best HMM Match : zf-C2H2 (HMM E-Value=1.3e-08) 34 0.089 SB_4758| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.089 SB_5870| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) 32 0.47 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.83 SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_11362| Best HMM Match : zf-C2H2 (HMM E-Value=7.9e-32) 31 1.1 SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_10066| Best HMM Match : GPS (HMM E-Value=8.6e-07) 29 2.5 SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 2.5 SB_46132| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_26947| Best HMM Match : LIM (HMM E-Value=6.2e-32) 29 2.5 SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 4.4 SB_32609| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 4.4 SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) 29 4.4 SB_52826| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.8 SB_18588| Best HMM Match : zf-C2H2 (HMM E-Value=0.0061) 28 5.8 SB_972| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_28794| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_21010| Best HMM Match : PHD (HMM E-Value=7e-10) 28 7.7 SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 7.7 SB_22059| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_11979| Best HMM Match : zf-C3HC4 (HMM E-Value=0.061) 28 7.7 SB_5864| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_40594| Best HMM Match : Extensin_2 (HMM E-Value=0.083) Length = 440 Score = 107 bits (258), Expect = 6e-24 Identities = 44/66 (66%), Positives = 56/66 (84%) Frame = +1 Query: 241 ESEAFKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNSLPNRSNIEIEIYGMEGIPPEDV 420 +++ FKC ICHKKLYTGPGL+IHC QVHKE + +PNSLPNR + EIEIYGMEGIP +D+ Sbjct: 31 KAKHFKCMICHKKLYTGPGLAIHCTQVHKETVSAIPNSLPNRGDPEIEIYGMEGIPEKDL 90 Query: 421 KEHEKQ 438 KE +++ Sbjct: 91 KERQQR 96 Score = 79.0 bits (186), Expect = 3e-15 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +2 Query: 152 MGRKKKKASKPWCWYCNREFDDEKILIQHQKAKH 253 MGRKKKK KPWCWYCNR+FDDEKILIQHQKAKH Sbjct: 1 MGRKKKKPMKPWCWYCNRDFDDEKILIQHQKAKH 34 >SB_56313| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-14) Length = 910 Score = 35.1 bits (77), Expect = 0.051 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +2 Query: 188 CWYCNREFDDEKILIQHQKAKHLNVTFVTKSCTQDLDCPYTACRYIKK 331 C C++EF E L++H+KA H N FV + C + + R+ KK Sbjct: 5 CDTCSKEFTQETNLVRHKKAIHGNRAFVCERCQKSFNRKDILKRHEKK 52 >SB_50411| Best HMM Match : zf-C2H2 (HMM E-Value=1.3e-08) Length = 108 Score = 34.3 bits (75), Expect = 0.089 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 188 CWYCNREFDDEKILIQHQKAKHLNVTFVTKSCTQDLD 298 C C++EF E L++H+KA H N FV + C + + Sbjct: 40 CDTCSKEFTQETNLVRHKKAIHGNRVFVCERCQKSFN 76 >SB_4758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 34.3 bits (75), Expect = 0.089 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = +2 Query: 188 CWYCNREFDDEKILIQHQKAKHLNVTFVTKSCTQDLDCPYTACRYIKK 331 C C +EF + L +H+++ H N +F + C Q L+ T R++KK Sbjct: 497 CDICKKEFSLKTNLARHKRSVHGNQSFQCEKCEQSLNRKDTFKRHMKK 544 >SB_5870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 32.7 bits (71), Expect = 0.27 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 652 AIXILGACMNGGIM*FIAKCPGYI 581 A+ + CMNGGI IA CPGYI Sbjct: 101 AMVTMRPCMNGGICEAIATCPGYI 124 >SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 32.7 bits (71), Expect = 0.27 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 6/49 (12%) Frame = +2 Query: 170 KASKPW-CWYCNREFDDEKILIQHQKAKHLNV-----TFVTKSCTQDLD 298 K +PW C YC+++F + + +H + HL V T+ K C D Sbjct: 203 KTERPWGCVYCSKKFKTKAKVAEHTRRTHLKVKPFSCTYCNKKCASKSD 251 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 238 SESEAFKCHICHKKLYTGPGLSIHCMQVHKE 330 ++ +KC IC KK GLSIH ++H E Sbjct: 484 TDERPYKCDICGKKFRQQGGLSIH-KKIHTE 513 >SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) Length = 509 Score = 31.9 bits (69), Expect = 0.47 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 238 SESEAFKCHICHKKLYTGPGLSIHCMQVH 324 S+ + FKCHICH++ ++ H M++H Sbjct: 422 SKEKPFKCHICHRRFAQSSSVTTH-MRIH 449 >SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1041 Score = 31.1 bits (67), Expect = 0.83 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 176 SKPW-CWYCNREFDDEKILIQHQKAKHLNVTFVTKSCT 286 +KP+ C YC R F+D ++L++H ++ F K C+ Sbjct: 929 TKPYKCQYCVRSFNDSQMLVRHIRSHTGEKPFKCKHCS 966 >SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 978 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = +1 Query: 247 EAFKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNSLPNRSNIEIEIYGMEGIPPEDV 420 +AFKC CHK + H + H +A P+S ++S+ E +EGI +DV Sbjct: 297 KAFKCEHCHKVFGHSFDRARHVKKFHSDAKPVTPSSQSDQSHELSE--AIEGIQNKDV 352 >SB_11362| Best HMM Match : zf-C2H2 (HMM E-Value=7.9e-32) Length = 382 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 220 KDSHPTSESEAFKCHICHKKLYTGPGLSIHCMQVHK 327 K +H E ++CH+C + G GL+ H HK Sbjct: 324 KITHEGGELAKYECHLCGARYTRGTGLTSHLKAKHK 359 >SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 214 RRKDSHPTSESEAFKCHICHKKLYTGPGLSIHCMQVHK 327 + K+SH E E +KC+ C K L+ H +++HK Sbjct: 633 KHKESHRIVEQEKWKCNWCEKSYTRKSNLTAH-LKMHK 669 >SB_10066| Best HMM Match : GPS (HMM E-Value=8.6e-07) Length = 1146 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -2 Query: 307 VWTVQVLCTAFCDKCDI*MLRFLMLDENLFVVKL 206 V +VQVLCT FC C + RF++L V KL Sbjct: 830 VTSVQVLCTDFCYFCSGSLYRFVLLLFRFSVQKL 863 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = -2 Query: 307 VWTVQVLCTAFCDKCDI*MLRFLMLDENLFVVKLPVTIPAPR 182 V +VQVLCTA C C + RF++L LF + + V + + R Sbjct: 613 VTSVQVLCTAPCYFCSDSLYRFVLL---LFRLSVQVRVTSVR 651 >SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1498 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 188 CWYCNREFDDEKILIQHQKAKHLNVTFVTKSCTQD 292 C C+R F + L H KA H NV +T S +D Sbjct: 593 CDDCDRAFKRPRDLETHSKAHHANVDKMTHSANED 627 >SB_46132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/59 (23%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = +2 Query: 188 CWYCNREFDDEKILIQHQKAKHLNVTFV-TKSCTQDLDCPYTACRYIKKP*TKYQIHCQ 361 C +C F + +H K +H N TF+ ++C DC ++ + T C+ Sbjct: 512 CMFCEEVFLSPGVFHKHLKDRHYNTTFIFCQNCHIMFDCEEDLAKHKETHTTNMIFKCE 570 >SB_26947| Best HMM Match : LIM (HMM E-Value=6.2e-32) Length = 648 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/68 (27%), Positives = 25/68 (36%) Frame = +2 Query: 155 GRKKKKASKPWCWYCNREFDDEKILIQHQKAKHLNVTFVTKSCTQDLDCPYTACRYIKKP 334 GR + KP C C DE I + + V C + DCP RY+ + Sbjct: 132 GRHHAETLKPRCAAC-----DEIIFAEQCTEAEDSCWHVQHFCCFECDCPLGGMRYVMRD 186 Query: 335 *TKYQIHC 358 Y HC Sbjct: 187 NKPYCCHC 194 >SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 4303 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 188 CWYCNREFDDEKILIQHQKAKHL 256 C YC +F+ +KIL+ H A HL Sbjct: 909 CKYCVLQFESKKILVSHLLAIHL 931 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 188 CWYCNREFDDEKILIQHQKAKHLNVT 265 C YC F E +I+H ++ H+ VT Sbjct: 764 CQYCGYYFKCETSIIRHMESNHIGVT 789 >SB_32609| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1741 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 235 TSESEAFKCHICHKKLYTGPGLSIH 309 T + FKC IC K+ T GL+ H Sbjct: 1299 TGNQKLFKCDICEKEFKTHVGLNFH 1323 >SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) Length = 803 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -2 Query: 592 PGYIPGGTGPMGVGNIPGXTVEGPAPSN 509 PG +PGG P G N PG + P PSN Sbjct: 662 PGVMPGGLTPGG--NTPGRGRKSPNPSN 687 >SB_52826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2126 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 164 KKKASKPWCWYCNREFDDEKILIQHQKAKHLNV 262 +K+ KP C C EFD + +L H H N+ Sbjct: 1311 EKRHMKPRCRECGLEFDHKNLLKIHMDCYHSNM 1343 >SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1346 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 238 SESEAFKCHICHKKLYTGPGLSIHCMQVHK 327 SE F C C K L HCM VH+ Sbjct: 1192 SEQRPFSCEQCMKSFNRSGDLRRHCMTVHE 1221 >SB_18588| Best HMM Match : zf-C2H2 (HMM E-Value=0.0061) Length = 503 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +1 Query: 217 RKDSHPTSESEAFKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNS 354 R D T E+ F C +C+K + L H H + D +P + Sbjct: 22 RADRTVTEETSDFICPMCNKSFFAAEELQSHFDLEHSASQDFIPET 67 >SB_972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 378 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = +2 Query: 179 KPWCWYCNREFDDEK----ILIQHQKAKH-LNVTFVTKSCTQDLDCPYTACRYIKKP*TK 343 K +C +C+REF++ + ++ H +H L + V + C C Y R ++P T Sbjct: 32 KVFCMFCDREFENTRGKNDAVLHHLLVEHQLVIADVAQICDMRRYCEYWKGRLKEEPITN 91 Query: 344 Y 346 + Sbjct: 92 F 92 >SB_28794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 27.9 bits (59), Expect = 7.7 Identities = 8/46 (17%), Positives = 23/46 (50%) Frame = -3 Query: 441 FLFLMFFHIFRGYTFHSINFYFYI*PIWQ*IWYFVYGFFMYLHAVY 304 + + +++ + Y +H +Y+Y + +Y+ Y ++ Y + Y Sbjct: 116 YYYYYYYYYYYYYYYHHYYYYYYYYYYYYYYYYYYYYYYYYYYYYY 161 >SB_21010| Best HMM Match : PHD (HMM E-Value=7e-10) Length = 389 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = +1 Query: 232 PTSESEAFKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNSLPNRSNIEI 381 P + + C IC ++ GPGL H + + D N+ + +I + Sbjct: 194 PEDRKKPYVCEICGRRYKNGPGLKYHYTHYNHDQ-DNTSNAAQDDHSISL 242 >SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 935 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/59 (25%), Positives = 23/59 (38%) Frame = +1 Query: 253 FKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNSLPNRSNIEIEIYGMEGIPPEDVKEH 429 F+C +CHK LS H VH++ + P P + G + P + H Sbjct: 484 FECPVCHKAFSQTGNLSKHVRYVHEK--QQRPKEKPRDKKYFCSLCGKAFLCPSSLSMH 540 >SB_22059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 204 GSLTTKRFSSNIRKRSI*MSHLSQKAVHRTWTVHTLH 314 G++ + IRK + H Q+A+HRT T H H Sbjct: 31 GTICNALLYAVIRKTPMRARHRPQQALHRTLTEHAFH 67 >SB_11979| Best HMM Match : zf-C3HC4 (HMM E-Value=0.061) Length = 63 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +1 Query: 238 SESEAFKCHICHKKLYTGPGLSIHCMQVHKE 330 S +E KC IC + YT P +SI C VH E Sbjct: 4 SVTEKVKCLICMEP-YTVPLVSISCWHVHCE 33 >SB_5864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +2 Query: 149 KMGRKKKKASKPW-CWYCNREFDDEKILIQHQKAKHLNVTFVTKSCTQDLDCPYTACRYI 325 K+ +K KP+ C C ++F LI+H++ F+ + C Q +C R++ Sbjct: 174 KVHMRKHTQEKPYECETCGKQFRVTSDLIRHKRIHTGCKPFLCEVCGQGFNCHANRNRHL 233 Query: 326 K 328 + Sbjct: 234 R 234 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,319,707 Number of Sequences: 59808 Number of extensions: 369565 Number of successful extensions: 1251 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1240 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -