BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060387.seq (656 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30970.1 68414.m03792 zinc finger (C2H2 type) family protein ... 84 7e-17 At5g63280.1 68418.m07942 zinc finger (C2H2 type) family protein ... 39 0.003 At5g40710.1 68418.m04941 zinc finger (C2H2 type) family protein ... 28 4.8 At1g71760.1 68414.m08294 hypothetical protein 28 4.8 At5g36870.1 68418.m04417 glycosyl transferase family 48 protein ... 28 6.3 At5g28720.1 68418.m03528 hypothetical protein 28 6.3 At3g44750.1 68416.m04817 histone deacetylase, putative (HD2A) co... 28 6.3 At1g24510.2 68414.m03085 T-complex protein 1 epsilon subunit, pu... 27 8.3 At1g24510.1 68414.m03086 T-complex protein 1 epsilon subunit, pu... 27 8.3 >At1g30970.1 68414.m03792 zinc finger (C2H2 type) family protein contains Pfam domain PF00096: Zinc finger, C2H2 type Length = 367 Score = 84.2 bits (199), Expect = 7e-17 Identities = 34/63 (53%), Positives = 46/63 (73%) Frame = +1 Query: 241 ESEAFKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNSLPNRSNIEIEIYGMEGIPPEDV 420 +++ FKCH+CHKKL T G+ IH +QVHKE + KVPN+ R + +IEIYGM+GIPP + Sbjct: 32 KAKHFKCHVCHKKLSTASGMVIHVLQVHKENVTKVPNAKDGRDSTDIEIYGMQGIPPHVL 91 Query: 421 KEH 429 H Sbjct: 92 TAH 94 Score = 66.5 bits (155), Expect = 1e-11 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = +2 Query: 152 MGRKKKKAS-KPWCWYCNREFDDEKILIQHQKAKH 253 MG+KKK+A+ K WC+YC+REFDDEKIL+QHQKAKH Sbjct: 1 MGKKKKRATEKVWCYYCDREFDDEKILVQHQKAKH 35 >At5g63280.1 68418.m07942 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 271 Score = 38.7 bits (86), Expect = 0.003 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = +2 Query: 188 CWYCNREFDDEKILIQHQKAKHLNVTFVTKS-CTQDLDCPYTACRYI---KKP*TK 343 C YC + F+DEK L +H +H N+ T + C DL C C ++ KKP +K Sbjct: 107 CGYCKKSFNDEKFLDKHFSTRHYNLLNTTDTKCLADL-CGALHCDFVLSSKKPKSK 161 >At5g40710.1 68418.m04941 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 272 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +2 Query: 188 CWYCNREFDDEKILIQHQKAKHLNVTFVTK-SCTQDL 295 C +C + F +EK L +H ++H N+ + C DL Sbjct: 109 CGFCKKAFYEEKYLDKHFDSRHYNLLNASHGKCLSDL 145 >At1g71760.1 68414.m08294 hypothetical protein Length = 259 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 158 RKKKKASKPWCWYCNREFDDEKILIQHQKAKHL 256 +KKK ++K C CN++ +K+ Q KAK L Sbjct: 21 QKKKSSNKWVCVICNQKQSVKKVFAQGYKAKEL 53 >At5g36870.1 68418.m04417 glycosyl transferase family 48 protein contains Pfam profile: PF02364 1,3-beta-glucan synthase Length = 1862 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/38 (26%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -3 Query: 576 VALAPWVWAISQVTLXKGLHPAIWSSF-FLGSWFIIIT 466 V L W W+ ++ + +G+H + WS + ++ W +++T Sbjct: 620 VKLIMW-WSQPELYIGRGMHESAWSIYKYMMFWIVLLT 656 >At5g28720.1 68418.m03528 hypothetical protein Length = 142 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +1 Query: 346 PNSLPNRSNIEIEIYGMEGIPPEDVKEH 429 P++L + ++E E Y +G+P +D++EH Sbjct: 87 PHTLGVQLDLEQEPYDDDGVPADDIEEH 114 >At3g44750.1 68416.m04817 histone deacetylase, putative (HD2A) contains Pfam domain, PF00096: Zinc finger, C2H2 type; identical to cDNA putative histone deacetylase (HD2A) GI:11066134 Length = 245 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 167 KKASKPWCWYCNREFDDEKILIQHQKAKH 253 K AS+ C C + F+ L H KAKH Sbjct: 213 KSASQVSCGSCKKTFNSGNALESHNKAKH 241 >At1g24510.2 68414.m03085 T-complex protein 1 epsilon subunit, putative / TCP-1-epsilon, putative / chaperonin, putative identical to SWISS-PROT:O04450- T-complex protein 1, epsilon subunit (TCP-1-epsilon) [Arabidopsis thaliana]; strong similarity to SP|P54411 T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon) (TCP-K36) {Avena sativa}; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 459 Score = 27.5 bits (58), Expect = 8.3 Identities = 12/46 (26%), Positives = 25/46 (54%) Frame = +1 Query: 292 PGLSIHCMQVHKEAIDKVPNSLPNRSNIEIEIYGMEGIPPEDVKEH 429 PG+ + ++ EA+D VP +L S ++ I + + + +KE+ Sbjct: 361 PGVEQYAIRAFAEALDSVPMALAENSGLQ-PIETLSAVKSQQIKEN 405 >At1g24510.1 68414.m03086 T-complex protein 1 epsilon subunit, putative / TCP-1-epsilon, putative / chaperonin, putative identical to SWISS-PROT:O04450- T-complex protein 1, epsilon subunit (TCP-1-epsilon) [Arabidopsis thaliana]; strong similarity to SP|P54411 T-complex protein 1, epsilon subunit (TCP-1-epsilon) (CCT-epsilon) (TCP-K36) {Avena sativa}; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 535 Score = 27.5 bits (58), Expect = 8.3 Identities = 12/46 (26%), Positives = 25/46 (54%) Frame = +1 Query: 292 PGLSIHCMQVHKEAIDKVPNSLPNRSNIEIEIYGMEGIPPEDVKEH 429 PG+ + ++ EA+D VP +L S ++ I + + + +KE+ Sbjct: 437 PGVEQYAIRAFAEALDSVPMALAENSGLQ-PIETLSAVKSQQIKEN 481 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,486,330 Number of Sequences: 28952 Number of extensions: 260761 Number of successful extensions: 873 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -