BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060386.seq (679 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 2.0 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 6.2 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 8.2 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 8.2 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 562 PVRRRYGPVLPNQSHRITASFQNFSHFGIQQ 470 P+ YGPV+P QS +T Q + ++Q Sbjct: 648 PLNVPYGPVIPEQS--LTYQDQQYQVVSVEQ 676 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 314 IGSQSVSSDGLRRR 355 +G Q+ + DGLRRR Sbjct: 425 VGEQARAQDGLRRR 438 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 669 VYVLCVIIVVL 637 VYV CV+IVVL Sbjct: 251 VYVPCVLIVVL 261 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 107 KLVVCRSDFYRTKTTQPEVIGCK 175 +L V SD+ + Q E IGCK Sbjct: 600 ELFVMVSDYKDDRVEQNEPIGCK 622 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,198 Number of Sequences: 438 Number of extensions: 3863 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -