Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV060385.seq
         (671 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory recept...    23   3.0  
DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7 prot...    21   6.9  
AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    21   9.2  

>AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory receptor
           candidate 34 protein.
          Length = 324

 Score = 22.6 bits (46), Expect = 3.0
 Identities = 7/32 (21%), Positives = 19/32 (59%)
 Frame = -1

Query: 647 KGRGSPRVLAMVAQQXMVFLYRISLLARPDCI 552
           K +  P +++ ++   ++FL+  +L+   DC+
Sbjct: 229 KSKFEPFLISNISLVSLIFLFNCTLIIMCDCV 260


>DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7
           protein.
          Length = 980

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 6/13 (46%), Positives = 8/13 (61%)
 Frame = +2

Query: 362 FRCVRARYHHLPC 400
           + C   R HH+PC
Sbjct: 935 YMCEGERKHHMPC 947


>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 21.0 bits (42), Expect = 9.2
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -2

Query: 148 CQHRRGTPACTCP 110
           CQ + G  AC CP
Sbjct: 432 CQDKLGDYACYCP 444


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,874
Number of Sequences: 336
Number of extensions: 2889
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17489640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)