BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060381.seq (564 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 71 3e-14 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 71 3e-14 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 71 3e-14 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 71 3e-14 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 27 0.56 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 26 0.74 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 26 0.74 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 26 0.74 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 5.2 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 23 6.9 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 23 6.9 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 6.9 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 9.1 AJ297931-1|CAC35451.1| 166|Anopheles gambiae hypothetical prote... 23 9.1 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 70.5 bits (165), Expect = 3e-14 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 386 HYTEGAELVDSVLDVVRKEAESCDCLQGFQLTH 484 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTH Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 Score = 27.5 bits (58), Expect = 0.32 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 531 KIREEYPDRIM 563 KIREEYPDRIM Sbjct: 50 KIREEYPDRIM 60 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 70.5 bits (165), Expect = 3e-14 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 386 HYTEGAELVDSVLDVVRKEAESCDCLQGFQLTH 484 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTH Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 Score = 27.5 bits (58), Expect = 0.32 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 531 KIREEYPDRIM 563 KIREEYPDRIM Sbjct: 50 KIREEYPDRIM 60 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 70.5 bits (165), Expect = 3e-14 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 386 HYTEGAELVDSVLDVVRKEAESCDCLQGFQLTH 484 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTH Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 Score = 27.5 bits (58), Expect = 0.32 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 531 KIREEYPDRIM 563 KIREEYPDRIM Sbjct: 50 KIREEYPDRIM 60 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 70.5 bits (165), Expect = 3e-14 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 386 HYTEGAELVDSVLDVVRKEAESCDCLQGFQLTH 484 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTH Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 Score = 27.5 bits (58), Expect = 0.32 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 531 KIREEYPDRIM 563 KIREEYPDRIM Sbjct: 50 KIREEYPDRIM 60 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 26.6 bits (56), Expect = 0.56 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 75 MREIVHIQAGQCGNQIGAKFWE 140 MRE + + GQ G QIG W+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 26.2 bits (55), Expect = 0.74 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 214 SMYTTMKPPAASTCPRHPRRLGARHH 291 S+YTT+ P+AST RH +RHH Sbjct: 13 SLYTTVSEPSASTKHRH----HSRHH 34 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 26.2 bits (55), Expect = 0.74 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 214 SMYTTMKPPAASTCPRHPRRLGARHH 291 S+YTT+ P+AST RH +RHH Sbjct: 13 SLYTTVSEPSASTKHRH----HSRHH 34 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 26.2 bits (55), Expect = 0.74 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 214 SMYTTMKPPAASTCPRHPRRLGARHH 291 S+YTT+ P+AST RH +RHH Sbjct: 13 SLYTTVSEPSASTKHRH----HSRHH 34 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.4 bits (48), Expect = 5.2 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 347 FGQSGAGNNWAKGHYTEGAELVDSVLDVV 433 FG G + G YT +E +D VLD + Sbjct: 343 FGLEQCGTDGVPGVYTRMSEYMDWVLDTM 371 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 23.0 bits (47), Expect = 6.9 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -1 Query: 423 KTESTSSAPSV*CPLAQLLPAPDCPKTKLSGRKICPKG 310 K T + + CPL ++ DC +L KI KG Sbjct: 195 KATGTKAHTAKYCPLKPVITPEDCLAMELRRHKIHRKG 232 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 23.0 bits (47), Expect = 6.9 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -1 Query: 423 KTESTSSAPSV*CPLAQLLPAPDCPKTKLSGRKICPKG 310 K T + + CPL ++ DC +L KI KG Sbjct: 196 KATGTKAHTAKYCPLKPVITPEDCLAMELRRHKIHRKG 233 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.0 bits (47), Expect = 6.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 Query: 129 KFWEIISDEHGIDPTG 176 KFW + D GI+ TG Sbjct: 225 KFWPTVCDYFGIESTG 240 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.6 bits (46), Expect = 9.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 176 TGGVDAVLVGDDLPELSSDLVAALTSLDMYD 84 TGG ++ L+G L++ LV +L L D Sbjct: 788 TGGTESQLIGAIFKTLATRLVQSLKELKSQD 818 >AJ297931-1|CAC35451.1| 166|Anopheles gambiae hypothetical protein protein. Length = 166 Score = 22.6 bits (46), Expect = 9.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 146 DDLPELSSDLVAALTSLDMYDFP 78 D +PE+ SDL L L + D P Sbjct: 21 DSVPEVPSDLQQQLDELQLADKP 43 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,598 Number of Sequences: 2352 Number of extensions: 11915 Number of successful extensions: 38 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -