BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060379.seq (571 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 7.4 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 7.4 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.0 bits (42), Expect = 7.4 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = -3 Query: 188 SKGNMPANGEGSLIACITTAPIALLARNQTSLSARASLT 72 SKGN NG S++A + A + + SLT Sbjct: 98 SKGNADQNGYASVVAAAAVKDVWQSATSGGGANLTNSLT 136 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 7.4 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +2 Query: 455 RLRLSKGKWKSSHRIPIHMNGVCVRWR 535 R++++ G W R+ + + GV +RWR Sbjct: 756 RIKIT-GVWLKFLRVILSVVGVKLRWR 781 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,011 Number of Sequences: 336 Number of extensions: 2484 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14099535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -