BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060379.seq (571 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0591 - 4401847-4402063,4402860-4403002,4403339-4403447,440... 29 2.0 01_01_0562 + 4126368-4128196,4128517-4128715,4128827-4128886,412... 28 4.6 02_05_0235 - 27068516-27069032,27069697-27069788,27070056-270702... 28 6.0 >01_01_0591 - 4401847-4402063,4402860-4403002,4403339-4403447, 4403546-4404707,4405754-4405865,4405980-4406015 Length = 592 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 386 GDSVYRYRHKPSACLRSLTLQQPRLRLSKGKWKSSHRIP 502 G + YR R + S LR+ + L+L G W ++ ++P Sbjct: 55 GGAPYRLRRRNSETLRAQYINTKELKLCVGTWNAAGKVP 93 >01_01_0562 + 4126368-4128196,4128517-4128715,4128827-4128886, 4129129-4129233,4129987-4130127,4130223-4130285, 4130925-4131152,4131250-4131333,4132000-4132157, 4132252-4132777,4133641-4133700,4133904-4134026, 4134906-4135181,4135282-4135347,4135500-4135631, 4135977-4136798,4137026-4137306,4137564-4137796, 4138022-4138260,4138367-4138558,4138808-4139080, 4139186-4139332 Length = 2078 Score = 28.3 bits (60), Expect = 4.6 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 4/67 (5%) Frame = +2 Query: 347 PDAVHERLPRGTHGDSVYRYRHKPSACLRSLTLQQPR-LRLSKG--KWKSSH-RIPIHMN 514 P AV + LP DSVY + + L Q+PR ++ + G K+K+S+ R+ +H+ Sbjct: 578 PGAVQQTLPITL--DSVYF--NGGNLMLLGYGDQEPREMKHANGHIKFKNSYNRVHVHVT 633 Query: 515 GVCVRWR 535 G C+ WR Sbjct: 634 GNCMEWR 640 >02_05_0235 - 27068516-27069032,27069697-27069788,27070056-27070289, 27071569-27071676,27071796-27071855,27072368-27072443, 27072550-27072710,27076919-27076981,27077061-27077148, 27077568-27078308,27078406-27079033,27079314-27079368, 27082073-27083527 Length = 1425 Score = 27.9 bits (59), Expect = 6.0 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 446 QQPRLRLSKGKWKSSHRIPIHMNGVC 523 + P RL +GK K +HR+P+ +C Sbjct: 882 ESPTRRLDEGKRKQTHRLPLPPLSIC 907 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,747,494 Number of Sequences: 37544 Number of extensions: 317658 Number of successful extensions: 995 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 995 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1317005676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -