BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060379.seq (571 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 1.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 3.7 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 1.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 420 QLVFDHSPYNNRGCDFQKENGKAH 491 +L PY DF KE+GK H Sbjct: 1017 RLSSSEKPYMFETVDFSKEDGKEH 1040 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/51 (19%), Positives = 23/51 (45%) Frame = +2 Query: 374 RGTHGDSVYRYRHKPSACLRSLTLQQPRLRLSKGKWKSSHRIPIHMNGVCV 526 R ++G +R + CL+S ++ + +G W S + + G+ + Sbjct: 40 RVSNGGKEQDFRFEAIQCLQSSAFKEIKTLPDRGMWSSKIEFILSVVGLAI 90 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,474 Number of Sequences: 438 Number of extensions: 3770 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -