BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060371.seq (663 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48927| Best HMM Match : DUF922 (HMM E-Value=0.62) 28 7.8 SB_6694| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 >SB_48927| Best HMM Match : DUF922 (HMM E-Value=0.62) Length = 262 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 529 RQWELVXGRSATDXPNQTRKENKPNHKMSKGSRHISQEGSKGIWQ 663 R W + G SA D +T + PN + SR I++E + WQ Sbjct: 157 RVWRQIEGMSA-DSTKRTVAKQPPNIETKARSRSINKEARQRPWQ 200 >SB_6694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 403 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 213 PHQHKQLSNFSRCPLRKFRIFMNYKSRLNNYLID 112 PH + L CP FR+FM+ K + ++D Sbjct: 207 PHVYYALEGLVSCPQNNFRVFMDGKMVYSQEILD 240 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,385,889 Number of Sequences: 59808 Number of extensions: 406560 Number of successful extensions: 1089 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1007 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1085 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -