BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060367.seq (689 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.2 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 9.5 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 9.5 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 9.5 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +3 Query: 510 NKMDSTEPPYSEPRFEEIKKEVSFIHSRRLGYNP 611 +K+ STE + P ++ + S +RR NP Sbjct: 474 DKLSSTEQLFIRPMYDAFLIDQSLALNRRRDENP 507 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +3 Query: 510 NKMDSTEPPYSEPRFEEIKKEVSFIHSRRLGYNP 611 +K+ STE + P ++ + S +RR NP Sbjct: 474 DKLSSTEQLFIRPMYDAFLIDQSLALNRRRDENP 507 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 339 QRFHQEHDHRNLS 377 + FH+EHD R S Sbjct: 260 RHFHEEHDTRRAS 272 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/21 (28%), Positives = 11/21 (52%) Frame = -1 Query: 671 EGSNMLSPCPSRNGHESDSSW 609 +G N + C +R G + + W Sbjct: 566 DGGNSMKKCRARYGLDQQNQW 586 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/21 (28%), Positives = 11/21 (52%) Frame = -1 Query: 671 EGSNMLSPCPSRNGHESDSSW 609 +G N + C +R G + + W Sbjct: 458 DGGNSMKKCRARYGLDQQNQW 478 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,496 Number of Sequences: 336 Number of extensions: 3625 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -