BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060361.seq (685 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23C4.16c |atg15||triacylglycerol lipase Atg15 |Schizosacchar... 28 1.1 SPAC6F12.02 |rst2||transcription factor Rst2|Schizosaccharomyces... 25 7.7 SPBC646.02 |cwf11||complexed with Cdc5 protein Cwf11 |Schizosacc... 25 7.7 >SPAC23C4.16c |atg15||triacylglycerol lipase Atg15 |Schizosaccharomyces pombe|chr 1|||Manual Length = 424 Score = 28.3 bits (60), Expect = 1.1 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 605 FLHLFIRRWAVSKLFPKLLNSSEDFPDKSN 516 FL FI R + + +F ++ SSE+ PDK N Sbjct: 12 FLFCFIIRISCTGVFESVIKSSENVPDKVN 41 >SPAC6F12.02 |rst2||transcription factor Rst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 567 Score = 25.4 bits (53), Expect = 7.7 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +2 Query: 92 QFEKGIKMQGPAVFMDISLEDQALELRRYFKSLGAEISEEKSPKGIEDD 238 + +GIK +G ++ +I+ +DQA YF S E E + E D Sbjct: 461 RISEGIKEEGISLSEEITDKDQAFASMGYFDSYNFEGVENSNSLNNEGD 509 >SPBC646.02 |cwf11||complexed with Cdc5 protein Cwf11 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1284 Score = 25.4 bits (53), Expect = 7.7 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 480 PCILSCHRTGARVGFVREVFTGVEQLRKEFANC-PPSNEQMQKL 608 P I + G + R +F VEQL+ NC PSN + L Sbjct: 652 PDICAFPNAGLNSIYARNLFNTVEQLQSVLPNCHVPSNLSTESL 695 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,520,270 Number of Sequences: 5004 Number of extensions: 47606 Number of successful extensions: 126 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -