BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060360.seq (690 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 25 1.7 AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 24 5.2 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 25.4 bits (53), Expect = 1.7 Identities = 14/55 (25%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = -3 Query: 682 HHHDPEVVCLYDIPH*RSPALRPDNQWSFR----RIFPQQPPMQYWLPLIQPQGI 530 HHH P + L P + L+P + +F I PQQ Q+ + ++ + + Sbjct: 164 HHHHPGLTGLMQAPSQQQQHLQPVHPLAFHPIGGPIVPQQQQQQHLMDAVRQRAV 218 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 23.8 bits (49), Expect = 5.2 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 150 GSAIAKIVGRNAASLSNFEDRVT 218 GSA++ + AS+ +F DR+T Sbjct: 260 GSAVSNLAQLTTASMQSFADRMT 282 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 666,076 Number of Sequences: 2352 Number of extensions: 13156 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -