BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060359.seq (677 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 29 0.035 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 7.0 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 7.0 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 29.1 bits (62), Expect = 0.035 Identities = 22/71 (30%), Positives = 31/71 (43%) Frame = +1 Query: 418 PSRQPPTAESGLGGSRCCYRVPALVQARGHILKRFPSXPWLYPTKSKRSTRPNRLHLXER 597 P P+ SGLGG +PAL GH L+ P P +Y + + R R Sbjct: 76 PYAPHPSLSSGLGGGLSGMPMPALGFGLGHPLESVP-FPQVYSYFAGVNPRKQRRERTTF 134 Query: 598 LKAWXDIL*GV 630 +A D+L G+ Sbjct: 135 TRAQLDLLEGL 145 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 7.0 Identities = 10/34 (29%), Positives = 13/34 (38%), Gaps = 3/34 (8%) Frame = -1 Query: 353 HPDRTYEYH---HHGHAEFGRQHVQYPMIQHWFG 261 HP T+ YH H+ F H + FG Sbjct: 158 HPGMTFRYHFNVHNSGTHFWHSHSGFQRSDGTFG 191 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.4 bits (43), Expect = 7.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 Query: 141 HPAPSHSSLNTPTL 100 HPA +HS+L +P + Sbjct: 121 HPAAAHSALLSPAM 134 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,647 Number of Sequences: 336 Number of extensions: 2829 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -