BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060359.seq (677 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 118 3e-27 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 118 3e-27 At1g76010.1 68414.m08825 expressed protein 30 1.2 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 2.1 At1g26400.1 68414.m03220 FAD-binding domain-containing protein s... 29 2.1 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 29 2.8 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 29 2.8 At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to S... 29 2.8 At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to S... 29 2.8 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 29 3.7 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 29 3.7 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 28 4.9 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 4.9 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 6.5 At3g12430.1 68416.m01548 expressed protein ; expression supporte... 28 6.5 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 27 8.6 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 118 bits (285), Expect = 3e-27 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +2 Query: 254 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 418 AGHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 64 AGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 118 Score = 58.4 bits (135), Expect = 4e-09 Identities = 30/59 (50%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = +3 Query: 84 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKE 254 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+ Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKK 63 Score = 32.3 bits (70), Expect = 0.30 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +3 Query: 510 IEKIPELXLVVPDKVQEINKTKQAASX*APQGMX*YPLRXQ-VXRLXAGKGKMRNR 674 IE +PE+ LVV D + + KT A G + + + GKGKMRNR Sbjct: 150 IENVPEMPLVVSDSAEAVEKTSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRNR 205 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 478 VPALVQARGHILKRFPSXP 534 VPALV ARGH ++ P P Sbjct: 139 VPALVMARGHKIENVPEMP 157 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 118 bits (285), Expect = 3e-27 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +2 Query: 254 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 418 AGHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 63 AGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 117 Score = 60.5 bits (140), Expect = 1e-09 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = +3 Query: 75 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 248 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 249 KE 254 K+ Sbjct: 61 KK 62 Score = 32.3 bits (70), Expect = 0.30 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +3 Query: 510 IEKIPELXLVVPDKVQEINKTKQAASX*APQGMX*YPLRXQ-VXRLXAGKGKMRNR 674 IE +PE+ LVV D + + KT A G + + + GKGKMRNR Sbjct: 149 IENVPEMPLVVSDSAEAVEKTSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRNR 204 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 478 VPALVQARGHILKRFPSXP 534 VPALV ARGH ++ P P Sbjct: 138 VPALVMARGHKIENVPEMP 156 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +2 Query: 248 QGAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRG 376 QG G + G GR R R RGGG R G G F N G Sbjct: 303 QGRGGYDGPQGRGRGRGRGRGGRGRGGG--RGGDGGFNNRSDG 343 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +3 Query: 99 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 245 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At1g26400.1 68414.m03220 FAD-binding domain-containing protein similar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 527 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 577 CLVLLISWTLSGTTKXSSGIFSICV 503 CLVLL+S + TK SGIF+ C+ Sbjct: 9 CLVLLVSILRAAVTKPDSGIFTGCL 33 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 389 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 270 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 389 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 270 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1050 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 248 QGAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGR 382 +G+G + + G GR R +GGG H+ G+G +GGR Sbjct: 15 EGSGSREAGPVSGGGRGSQRGGFQQGGGQHQGGRGYTPQPQQGGR 59 >At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1048 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 248 QGAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGR 382 +G+G + + G GR R +GGG H+ G+G +GGR Sbjct: 15 EGSGSREAGPVSGGGRGSQRGGFQQGGGQHQGGRGYTPQPQQGGR 59 >At2g43680.2 68415.m05430 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 669 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 373 WWTYVRPHEALAALAPSRQPPTAESGLGGSRCC 471 WW +V LA+ APS P + L SR C Sbjct: 465 WWNWVDRQNPLASPAPSYSQPQRDFRLTPSRLC 497 >At2g43680.1 68415.m05429 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 668 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 373 WWTYVRPHEALAALAPSRQPPTAESGLGGSRCC 471 WW +V LA+ APS P + L SR C Sbjct: 464 WWNWVDRQNPLASPAPSYSQPQRDFRLTPSRLC 496 >At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; glycine-rich protein 18 (GRP18) PMID:11431566; Length = 228 Score = 28.3 bits (60), Expect = 4.9 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Frame = +2 Query: 224 LEAALLREQGAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQ---GAFGNMCRGGRMFAP 394 + AL+R + G + +AE + + + ++P G G G+ G FGN GG F Sbjct: 76 MAVALIRRR-MGAKPTAEGTSSAQPLLKLPVYGGYGGFWGGKKFSGTFGNKPGGGNPFGD 134 Query: 395 TKPW 406 W Sbjct: 135 ISKW 138 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 150 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 245 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 150 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 245 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -1 Query: 377 HHDTCYRRHPDRTYEYHHHGHAEF 306 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At3g12430.1 68416.m01548 expressed protein ; expression supported by MPSS Length = 238 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -3 Query: 153 GAWLHPAPSHSSLNTPTLKVGLPID--SFRYFSEAIPLKY 40 G W+H SH+ ++ L VG+ + Y+S + P++Y Sbjct: 38 GQWIHDVLSHNRFSSHPLVVGVGVQWTPSSYYSASSPVRY 77 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.5 bits (58), Expect = 8.6 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -1 Query: 377 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 294 HHD + H D +++ HH H H Sbjct: 311 HHDHDHDHHHDHNHDHDHHHHDGHDHHH 338 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,499,027 Number of Sequences: 28952 Number of extensions: 274261 Number of successful extensions: 887 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 874 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -