BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060358.seq (603 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 25 1.9 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 24 3.3 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 25.0 bits (52), Expect = 1.9 Identities = 10/26 (38%), Positives = 20/26 (76%), Gaps = 2/26 (7%) Frame = +2 Query: 293 QSLDIVDAIPL-FH-HSHYVSPMAEV 364 + +D++D +PL +H H+H+ SPM+ + Sbjct: 444 RGMDLMDDMPLPYHDHNHHNSPMSPI 469 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 24.2 bits (50), Expect = 3.3 Identities = 10/41 (24%), Positives = 22/41 (53%) Frame = +2 Query: 296 SLDIVDAIPLFHHSHYVSPMAEVALTQIETIAQSENRVIAG 418 +LD+ + P+F+ S S + ++ T + + Q+ N +G Sbjct: 588 NLDLANLDPVFNSSELRSVLGSLSTTDLNRLEQTANMQTSG 628 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 547,531 Number of Sequences: 2352 Number of extensions: 9799 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -