BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060356.seq (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 149 2e-36 SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_8111| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 67 1e-11 SB_57454| Best HMM Match : DUF924 (HMM E-Value=1) 60 1e-09 SB_25097| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_25096| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) 52 4e-07 SB_22388| Best HMM Match : Extensin_2 (HMM E-Value=0.086) 52 6e-07 SB_49248| Best HMM Match : Cpn60_TCP1 (HMM E-Value=1.6) 38 0.008 SB_56262| Best HMM Match : Cpn60_TCP1 (HMM E-Value=6.6e-15) 33 0.22 SB_18642| Best HMM Match : CsrA (HMM E-Value=8.7) 33 0.29 SB_11519| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_21416| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_20267| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_4638| Best HMM Match : DUF1283 (HMM E-Value=0.46) 28 8.1 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 149 bits (361), Expect = 2e-36 Identities = 69/102 (67%), Positives = 87/102 (85%) Frame = +1 Query: 325 DVEHQIGKLLVQLAQSQDDEIGDGTTGVVVLAGALLEQASNLLDKGIHPIRIADGYEMAA 504 +V+HQI KL+V+L++SQD+EIGDGTTGVVVLAGALLE A LLD GIHPIRIADGYE+AA Sbjct: 80 EVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAA 139 Query: 505 ARALTHLDSVSEAFPVNKNTRGNLIKVXMTTLGSKVVVXCHR 630 AL H+DS+++ FPV+K+ + +LI+ MTTLGSK+V CHR Sbjct: 140 KIALEHMDSIADNFPVDKDNKESLIQTAMTTLGSKIVSRCHR 181 Score = 68.9 bits (161), Expect = 4e-12 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +3 Query: 183 KSHIQAXRQIASTLRTSLGPRGS*KLMVSSDGDVTVTNDGATILKMM 323 +SHI A R +AS L+TSLGP+G K+MVS DG+VTVTNDGATIL MM Sbjct: 33 QSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMM 79 >SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 762 Score = 69.3 bits (162), Expect = 3e-12 Identities = 35/95 (36%), Positives = 60/95 (63%) Frame = +1 Query: 328 VEHQIGKLLVQLAQSQDDEIGDGTTGVVVLAGALLEQASNLLDKGIHPIRIADGYEMAAA 507 ++H L+ ++A +QDD GDGTT V++ G LL+QA + +G+HP + +G+E+A Sbjct: 171 IQHPTASLIARVATAQDDITGDGTTSNVMIIGELLKQADLYVSEGLHPRLVTEGFEVAKK 230 Query: 508 RALTHLDSVSEAFPVNKNTRGNLIKVXMTTLGSKV 612 +AL L+ V + ++++T LI V T+L +KV Sbjct: 231 KALEVLEEVKVSREMDRDT---LINVAKTSLRTKV 262 >SB_8111| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 531 Score = 66.9 bits (156), Expect = 1e-11 Identities = 37/102 (36%), Positives = 60/102 (58%), Gaps = 1/102 (0%) Frame = +1 Query: 328 VEHQIGKLLVQLAQSQDDEIGDGTTGVVVLAGALLEQASNLLDKGIHPIRIADGYEMAAA 507 +++ K+LV+L++ QDDE+GDGTT V VL LL++A L+ IHP I G+ + Sbjct: 73 IDNPAAKILVELSKVQDDEVGDGTTSVTVLTSELLKEAEKLVSCKIHPQTIVAGWRKSVK 132 Query: 508 RALTHLDSVSEAFPVN-KNTRGNLIKVXMTTLGSKVVVXCHR 630 A L++ + + + R +L+ + TTL SK++V HR Sbjct: 133 AAEKALEAAAVDHSSDPEKFREDLMNIARTTLSSKILVQ-HR 173 Score = 41.9 bits (94), Expect = 5e-04 Identities = 23/68 (33%), Positives = 41/68 (60%), Gaps = 2/68 (2%) Frame = +3 Query: 129 IILRDQDRQKRLTGTDAIKSHIQAXRQIASTLRTSLGPRGS*KLMVS--SDGDVTVTNDG 302 + + +Q ++ T + S + A I ++++LGP+G K++ S +G++ VTNDG Sbjct: 6 VSILNQGAEEERAETARLSSFVGAIA-IGDLVKSTLGPKGMDKILQSFGQNGNIQVTNDG 64 Query: 303 ATILKMMG 326 ATILK +G Sbjct: 65 ATILKSIG 72 >SB_57454| Best HMM Match : DUF924 (HMM E-Value=1) Length = 144 Score = 60.5 bits (140), Expect = 1e-09 Identities = 35/91 (38%), Positives = 53/91 (58%), Gaps = 1/91 (1%) Frame = +1 Query: 361 LAQSQDDEIGDGTTGVVVLAGALLEQASNLLDKGIHPIRIADGYEMAAARALTHLDSVSE 540 L++ QDDE+GDGTT V VLA LL++A L+ IHP I G+ + A L++ + Sbjct: 2 LSKVQDDEVGDGTTSVTVLASELLKEAEKLVSCKIHPQTIVAGWRKSVKAAEKALEAAAV 61 Query: 541 AFPVN-KNTRGNLIKVXMTTLGSKVVVXCHR 630 + + R +L+ + TTL SK++V HR Sbjct: 62 DHSSDPEKFRDDLMNIARTTLSSKILVQ-HR 91 >SB_25097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/86 (30%), Positives = 49/86 (56%), Gaps = 1/86 (1%) Frame = +1 Query: 328 VEHQIGKLLVQLAQSQDDEIGDGTTGVVVLAGALLEQASNLLDKGIHPIRIADGYEMAAA 507 V+H K +++++++QD+E+GDGTT V++LAG + A L++ +HP +I Y +A Sbjct: 14 VKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQQMHPTQIIAAYRLAMD 73 Query: 508 RALTHL-DSVSEAFPVNKNTRGNLIK 582 + L + E T G+ ++ Sbjct: 74 DMIDILKQQIREELQYRSRTYGHCLR 99 >SB_25096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/86 (30%), Positives = 49/86 (56%), Gaps = 1/86 (1%) Frame = +1 Query: 328 VEHQIGKLLVQLAQSQDDEIGDGTTGVVVLAGALLEQASNLLDKGIHPIRIADGYEMAAA 507 V+H K +++++++QD+E+GDGTT V++LAG + A L++ +HP +I Y +A Sbjct: 211 VKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQQMHPTQIIAAYRLAMD 270 Query: 508 RALTHL-DSVSEAFPVNKNTRGNLIK 582 + L + E T G+ ++ Sbjct: 271 DMIDILKQQIREELQYRSRTYGHCLR 296 >SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) Length = 186 Score = 52.0 bits (119), Expect = 4e-07 Identities = 22/42 (52%), Positives = 32/42 (76%) Frame = +3 Query: 186 SHIQAXRQIASTLRTSLGPRGS*KLMVSSDGDVTVTNDGATI 311 ++I A + +A +RTSLGP+G K++ +GDVT+TNDGATI Sbjct: 28 TNITAAKAVADAIRTSLGPKGMDKMIQGGNGDVTITNDGATI 69 >SB_22388| Best HMM Match : Extensin_2 (HMM E-Value=0.086) Length = 724 Score = 51.6 bits (118), Expect = 6e-07 Identities = 24/52 (46%), Positives = 35/52 (67%) Frame = +3 Query: 168 GTDAIKSHIQAXRQIASTLRTSLGPRGS*KLMVSSDGDVTVTNDGATILKMM 323 G + S+I A + IA +RT+LGPRG KL+V G T++NDGATI+ ++ Sbjct: 653 GIPQLISNIDACQFIADAVRTTLGPRGMDKLIVDGRGKATISNDGATIINLL 704 >SB_49248| Best HMM Match : Cpn60_TCP1 (HMM E-Value=1.6) Length = 278 Score = 37.9 bits (84), Expect = 0.008 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 1/103 (0%) Frame = +3 Query: 12 LRRTEILNLFSSFVCALFKS*KMALFPGSVAFDEYGRPFIILRDQDRQKRLT-GTDAIKS 188 LRR+ L+ ++S+ +L + L+ G F R Q+ K L G +A + Sbjct: 19 LRRSTFLHTWTSYASSLQAYRRSELY-------SLGEGFSTSRFQNSPKELKFGAEARAA 71 Query: 189 HIQAXRQIASTLRTSLGPRGS*KLMVSSDGDVTVTNDGATILK 317 +Q +A + +LGP+G ++ S G +T DG T+ K Sbjct: 72 MLQGVDTLADAVAVTLGPKGKNVIIEQSFGGPKITKDGVTVAK 114 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +1 Query: 325 DVEHQIGKLLVQ-LAQSQDDEIGDGTTGVVVLAGALLEQASNLLDKGIHPIRIA 483 D IG LVQ +A + ++E GDGTT VLA ++ + + KG +P ++ Sbjct: 120 DKYQNIGARLVQDVANNTNEEAGDGTTTATVLARSIATEGFLHVSKGANPQEVS 173 >SB_56262| Best HMM Match : Cpn60_TCP1 (HMM E-Value=6.6e-15) Length = 563 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 192 IQAXRQIASTLRTSLGPRGS*KLMVSSDGDVTVTNDGATILKMM 323 +Q + L+ S GP G ++ SS G++ +TN G+ IL+ + Sbjct: 6 LQTCQNFERILKKSFGPNGLDVMLRSSSGNILITNSGSMILESL 49 >SB_18642| Best HMM Match : CsrA (HMM E-Value=8.7) Length = 293 Score = 32.7 bits (71), Expect = 0.29 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = -2 Query: 439 LAQGVHQQEQQPLWYHHQFRHLDSEPIAQVVYQSDAQRPIIFRIVAPSFVTVTSPSDDTI 260 L Q + +Q L+ HH L A ++Y + A +I + PSF+T+T P + I Sbjct: 86 LPQSIIRQTATKLFNHHAATILYYHHAATMLYSNHATTMLITVTLLPSFITITLPPSNII 145 >SB_11519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 326 TLSIRLVNYLCNWLRVKMTKLVMVPQGLLFL 418 TL + +V +LC W + + L+ +G+LFL Sbjct: 241 TLFVTVVGFLCCWTPILIMDLIEFARGILFL 271 >SB_21416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 295 FVTVTSPSDDTISFQDPRGPRDVRRVLAI 209 F T+++PS TIS + P+D RRV AI Sbjct: 121 FSTISNPSKTTISRVNISTPQDFRRVSAI 149 >SB_20267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 556 KNTRGNLIKVXMTTLGSKVVVXCHRLIGRNSC*CCPGCXRL 678 +N R ++++ +TT+ V C L SC C GC L Sbjct: 34 QNIRRFVVEICVTTMNLATVKNCLVLASAKSCPCTCGCEDL 74 >SB_4638| Best HMM Match : DUF1283 (HMM E-Value=0.46) Length = 986 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/77 (24%), Positives = 33/77 (42%) Frame = -2 Query: 508 GRQPSHNHRLYESDGYLCPTDLRLAQGVHQQEQQPLWYHHQFRHLDSEPIAQVVYQSDAQ 329 GR LYE +CPT + H ++ ++ H P+ + S AQ Sbjct: 833 GRFSEEIKLLYEDKYDVCPTQSVTTKSTHGYDKVEVFITHDEPATQYIPVEKARSSSVAQ 892 Query: 328 RPIIFRIVAPSFVTVTS 278 + +I I+ +F+ VT+ Sbjct: 893 KAVILVII--NFICVTT 907 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,227,234 Number of Sequences: 59808 Number of extensions: 492210 Number of successful extensions: 1154 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1074 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1149 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -