BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060352.seq (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 26 0.39 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 4.8 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 6.3 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 6.3 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 21 8.4 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 25.8 bits (54), Expect = 0.39 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 218 SSPSHSFRRASGSSAVEPAPTSSTNAILFSCVC 120 SSP + A+ S++ P P SST A L C Sbjct: 825 SSPRYLSAAATSSTSTSPRPASSTAATLVLSGC 857 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 453 PRTTEPCTVRQEKDNSD 503 PR T +++ E DNSD Sbjct: 216 PRLTNSNSIKHESDNSD 232 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -1 Query: 160 RLPLPTPFYFPVFVAAFKLRYYS 92 R+ + + +FP+ A F L Y+S Sbjct: 414 RIDVISRIFFPIVFAFFNLAYWS 436 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -1 Query: 160 RLPLPTPFYFPVFVAAFKLRYYS 92 R+ + + +FP+ A F L Y+S Sbjct: 414 RIDVISRIFFPIVFAFFNLAYWS 436 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/34 (23%), Positives = 16/34 (47%) Frame = +1 Query: 319 WQISKKRKTLILTPFWANYALSIPNMTKNYLECH 420 W + K+ K ++ + + S+P +LE H Sbjct: 147 WDVDKRGKIMLSFAWIGSVVCSLPQTIVFHLETH 180 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,506 Number of Sequences: 438 Number of extensions: 3877 Number of successful extensions: 31 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -