BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060349.seq (695 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 28 0.097 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 3.7 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 22 4.8 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 4.8 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 8.5 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 27.9 bits (59), Expect = 0.097 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -2 Query: 565 VSTTLNSTARMPPRTMKVSHDGSDGKPP*STASS 464 V T++S + PPR+++ S+D S G P S+ SS Sbjct: 49 VENTISSVPQ-PPRSLEGSYDSSSGDSPVSSHSS 81 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.6 bits (46), Expect = 3.7 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = -2 Query: 232 CVTTEELKLLHFGL*KCHD*VVIADCFFDNETVGSVLATEDR 107 CV+ E L + L CH VV C + L TEDR Sbjct: 301 CVSGEHLSVSGGALNDCHAEVVARRCLCEYLYKQLELHTEDR 342 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 87 LLLSAILFKIYC*NLRTIIIFIT 19 +LLS+ F++ L TI+IF+T Sbjct: 1 MLLSSAWFEVIAAVLLTILIFVT 23 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 22.2 bits (45), Expect = 4.8 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 271 CKRFPWAFALEQ 236 CK FPW F +++ Sbjct: 292 CKAFPWHFVVDR 303 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/41 (24%), Positives = 16/41 (39%) Frame = +3 Query: 543 VEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEXEALNAG 665 + + T I+ P C+ PIKR ++ N G Sbjct: 114 ITLNIESTSNKMTVILTPPGRFFCEVRPIKRVKDSTNCNCG 154 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,709 Number of Sequences: 438 Number of extensions: 4127 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -