BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060349.seq (695 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03340.1 68418.m00286 cell division cycle protein 48, putativ... 120 7e-28 At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A)... 120 7e-28 At3g53230.1 68416.m05865 cell division cycle protein 48, putativ... 115 3e-26 At4g13885.1 68417.m02151 3'-5' exonuclease-related contains weak... 31 0.96 At3g26630.1 68416.m03328 pentatricopeptide (PPR) repeat-containi... 30 1.3 At5g17580.1 68418.m02062 phototropic-responsive NPH3 family prot... 28 6.8 At5g10520.1 68418.m01218 protein kinase family protein contains ... 27 9.0 At5g05980.1 68418.m00662 dihydrofolate synthetase/folylpolygluta... 27 9.0 At1g49400.1 68414.m05537 ribosomal protein S17 family protein si... 27 9.0 >At5g03340.1 68418.m00286 cell division cycle protein 48, putative / CDC48, putative very strong similarity to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain; supporting cDNA gi|26449351|dbj|AK117125.1| Length = 810 Score = 120 bits (290), Expect = 7e-28 Identities = 51/91 (56%), Positives = 66/91 (72%) Frame = +1 Query: 235 LAQGQTPKETVCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 414 L +G+ K+TVCI L+D+ C + KIRM DV+S+ CP VKYGKRVHIL Sbjct: 62 LIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHIL 121 Query: 415 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHR 507 P+DD+VEG+TGNLF+ YLKPYF+EAYRP+ + Sbjct: 122 PVDDTVEGVTGNLFDAYLKPYFLEAYRPVRK 152 Score = 85.4 bits (202), Expect = 3e-17 Identities = 38/60 (63%), Positives = 50/60 (83%) Frame = +2 Query: 74 ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 253 +D+K+ D STAIL RK PNRL+V+EA++DDNSVV+L ME+LQLFRGDT+L+KGK+ Sbjct: 8 SDSKTKKDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPTTMEKLQLFRGDTILIKGKK 67 Score = 81.0 bits (191), Expect = 7e-16 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = +3 Query: 510 DTFMVRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEE 644 D F+VRGGMR+VEFKV+ETDP+ +C+VAPDT I C+GEP+KRE+E Sbjct: 154 DLFLVRGGMRSVEFKVIETDPAEYCVVAPDTEIFCEGEPVKREDE 198 >At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A) (CDC48) identical to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana} Length = 809 Score = 120 bits (290), Expect = 7e-28 Identities = 51/91 (56%), Positives = 66/91 (72%) Frame = +1 Query: 235 LAQGQTPKETVCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 414 L +G+ K+TVCI L+D+ C + KIRM DV+S+ CP VKYGKRVHIL Sbjct: 62 LIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHIL 121 Query: 415 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHR 507 P+DD+VEG+TGNLF+ YLKPYF+EAYRP+ + Sbjct: 122 PVDDTVEGVTGNLFDAYLKPYFLEAYRPVRK 152 Score = 88.2 bits (209), Expect = 5e-18 Identities = 40/60 (66%), Positives = 51/60 (85%) Frame = +2 Query: 74 ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 253 +D+KS D STAIL RK PNRL+V+EA++DDNSVV+L A ME+LQLFRGDT+L+KGK+ Sbjct: 8 SDSKSKKDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKK 67 Score = 81.4 bits (192), Expect = 5e-16 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = +3 Query: 510 DTFMVRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEXEALNAG 665 D F+VRGGMR+VEFKV+ETDP+ +C+VAPDT I C+GEP+KRE+E + G Sbjct: 154 DLFLVRGGMRSVEFKVIETDPAEYCVVAPDTEIFCEGEPVKREDEERLDDVG 205 >At3g53230.1 68416.m05865 cell division cycle protein 48, putative / CDC48, putative very strong similarity to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain Length = 815 Score = 115 bits (277), Expect = 3e-26 Identities = 47/91 (51%), Positives = 65/91 (71%) Frame = +1 Query: 235 LAQGQTPKETVCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 414 L +G+ K+TVCI L+D+ C + KIRM DV+S+ CP VKYG RVHIL Sbjct: 63 LIKGKKRKDTVCIALADETCDEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGNRVHIL 122 Query: 415 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHR 507 P+DD++EG++GN+F+ YLKPYF+EAYRP+ + Sbjct: 123 PLDDTIEGVSGNIFDAYLKPYFLEAYRPVRK 153 Score = 81.0 bits (191), Expect = 7e-16 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = +3 Query: 510 DTFMVRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEE 644 D F+VRGGMR++EFKV+ETDP+ +C+VAPDT I C+GEPIKRE+E Sbjct: 155 DLFLVRGGMRSIEFKVIETDPAEYCVVAPDTEIFCEGEPIKREDE 199 Score = 75.8 bits (178), Expect = 3e-14 Identities = 36/61 (59%), Positives = 49/61 (80%), Gaps = 1/61 (1%) Frame = +2 Query: 74 ADNK-SPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGK 250 +D+K + D STAIL +K NRL+V+EA++DDNSVV+L ME+LQLFRGDT+L+KGK Sbjct: 8 SDSKGTKKDFSTAILEKKKAANRLVVDEAINDDNSVVSLHPDTMEKLQLFRGDTILIKGK 67 Query: 251 R 253 + Sbjct: 68 K 68 >At4g13885.1 68417.m02151 3'-5' exonuclease-related contains weak similarity to Pfam domain PF01612: 3'-5' exonuclease Length = 263 Score = 30.7 bits (66), Expect = 0.96 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -2 Query: 226 TTEELKLLHFGL*KCHD*VVIAD 158 TTEELK+ H+ L KC D +V+A+ Sbjct: 3 TTEELKISHYKLYKCFDFLVVAN 25 >At3g26630.1 68416.m03328 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 455 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 381 RTRSDGYHIRKTHTKVVSHNTVHPNFLIRAII 286 RT S+ +++ HTK++ HN + L+R +I Sbjct: 28 RTCSNFSQLKQIHTKIIKHNLTNDQLLVRQLI 59 >At5g17580.1 68418.m02062 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 548 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 499 IHRATPSWSAGACAPSSSKWSKQIHHHF 582 ++ ++ S+S AC K K+IHHH+ Sbjct: 520 LNSSSSSYSVDACTCDVKKKKKKIHHHY 547 >At5g10520.1 68418.m01218 protein kinase family protein contains protein kinase domain, INTERPRO:IPR000719 Length = 467 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +3 Query: 69 KWQIIKALMIYR-PRSSVARTDPTVSLSKKQSAMTTQSWHFHRPKWSNF 212 ++ +I L Y R ++ R P L+ +SA T +++ +P W NF Sbjct: 95 RFSVIPLLASYELTRKNLRRKQP--KLTPSESAFTCEAFFMAKPSWRNF 141 >At5g05980.1 68418.m00662 dihydrofolate synthetase/folylpolyglutamate synthetase (DHFS/FPGS2) nearly identical to gi:17976705; identical to cDNA dihydrofolate synthetase/folylpolyglutamate synthetase (dhfs/fpgs2 gene) GI:17976704 Length = 571 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 554 FELDGAHAPADHEGVARW 501 F LDGAH+P E A+W Sbjct: 382 FYLDGAHSPESMEACAKW 399 >At1g49400.1 68414.m05537 ribosomal protein S17 family protein similar to 40S ribosomal protein S17 GI:1620985 from [Nicotiana plumbaginifolia] Length = 116 Score = 27.5 bits (58), Expect = 9.0 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = +3 Query: 48 SNNKF*IKWQIIKALMIYRPRSSVARTDPTVSLSKKQSAMTTQS 179 S NK I +IIK IY P+++ A + S S SA TT S Sbjct: 64 SKNKHWIVAEIIKKARIYSPKAAAAAVSASASAS---SASTTDS 104 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,225,307 Number of Sequences: 28952 Number of extensions: 316118 Number of successful extensions: 886 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 886 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -