BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060343.seq (689 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28488| Best HMM Match : PAX (HMM E-Value=0) 31 0.67 SB_42634| Best HMM Match : Trypan_PARP (HMM E-Value=0.12) 28 8.2 >SB_28488| Best HMM Match : PAX (HMM E-Value=0) Length = 551 Score = 31.5 bits (68), Expect = 0.67 Identities = 28/114 (24%), Positives = 51/114 (44%), Gaps = 1/114 (0%) Frame = +3 Query: 309 KKKKEAIDGQARELIYKVIKFFE-SEKQNRGYAFPVENVVKRACAATGLSESTIKRIKRD 485 K++K+ D + +E KV K + N ++ + +++K+ A S +K IK + Sbjct: 172 KERKDEEDDKGKE-DEKVEKNSSLPSRHNFSSSYSIASILKKPSAEEDGSAEIVKGIKVE 230 Query: 486 GLRAEGTSTRMTGPKKRRVRKTKVQLDYFQLCALRSIVNGLLRCVREVPTLGKI 647 GL E +S+ KRR ++ Q L ++ C ++P GKI Sbjct: 231 GLVFESSSSATQEKDKRRRQRLDQQAQI--LLPTGHVLMSSNGCTNQIPGQGKI 282 >SB_42634| Best HMM Match : Trypan_PARP (HMM E-Value=0.12) Length = 436 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -2 Query: 544 LTLLFLGPVIRVEVPSARKPSRFILLIVL 458 L ++ LG ++RV V S RKP+ I L+V+ Sbjct: 288 LAVVSLGELVRVHVSSQRKPALKISLLVM 316 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,352,241 Number of Sequences: 59808 Number of extensions: 295126 Number of successful extensions: 796 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 794 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -