BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060340.seq (684 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 3.1 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 9.4 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 9.4 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 9.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.4 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.6 bits (46), Expect = 3.1 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +2 Query: 452 FTILWNCR 475 FTILWNC+ Sbjct: 285 FTILWNCQ 292 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 Query: 481 DASTIPKDCKAQISP 437 D S PK+CK P Sbjct: 470 DGSVAPKECKQDFMP 484 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -2 Query: 239 GLLFCSPTCVPIFSSTPLNFCRRPSRSTTRT 147 G + CSP C +F L + TTR+ Sbjct: 222 GCVLCSPGCFSLFRGKALMDKSVMKKYTTRS 252 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -2 Query: 239 GLLFCSPTCVPIFSSTPLNFCRRPSRSTTRT 147 G + CSP C +F L + TTR+ Sbjct: 536 GCVLCSPGCFSLFRGKALMDKSVMKKYTTRS 566 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -2 Query: 239 GLLFCSPTCVPIFSSTPLNFCRRPSRSTTRT 147 G + CSP C +F L + TTR+ Sbjct: 769 GCVLCSPGCFSLFRGKALMDKSVMKKYTTRS 799 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -2 Query: 239 GLLFCSPTCVPIFSSTPLNFCRRPSRSTTRT 147 G + CSP C +F L + TTR+ Sbjct: 769 GCVLCSPGCFSLFRGKALMDKSVMKKYTTRS 799 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,940 Number of Sequences: 336 Number of extensions: 3873 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -