BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060338.seq (647 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 25 0.54 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 3.8 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 8.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 8.7 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 25.0 bits (52), Expect = 0.54 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 1 RHEEEVEHLFASADDDHDDV 60 + +EEVEH + DDD +++ Sbjct: 23 KEDEEVEHRLSDRDDDDENI 42 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.2 bits (45), Expect = 3.8 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 191 LTPFHRFNLNXI*LATXPXFGTVIYYXFLHYLMYVIIHINLS 316 +TPF+ FN N I + T + L +++ + + NLS Sbjct: 420 ITPFYNFNENTIHSKLCKLYATFLIALKLVWIVALFKNENLS 461 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 307 KPFSSITLYIKKNRVKI 357 KP ++ LY+K+ R K+ Sbjct: 481 KPLNAFMLYMKEMRAKV 497 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 307 KPFSSITLYIKKNRVKI 357 KP ++ LY+K+ R K+ Sbjct: 373 KPLNAFMLYMKEMRAKV 389 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,957 Number of Sequences: 336 Number of extensions: 2248 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -