SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV060336.seq
         (685 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY600516-1|AAT11864.1|  143|Tribolium castaneum optomotor-blind-...    23   2.3  
AY600515-1|AAT11863.1|  134|Tribolium castaneum optomotor-blind-...    23   2.3  
AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembran...    22   4.1  
AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembran...    22   4.1  

>AY600516-1|AAT11864.1|  143|Tribolium castaneum
           optomotor-blind-like protein protein.
          Length = 143

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = +3

Query: 468 ECVSEGDQEIRFRLSAWPVTFTADPEERQESWLQNHP 578
           + V+  D   +F  S W V   ADPE  +  ++  HP
Sbjct: 24  DIVAADDCRYKFHNSRWMVAGKADPEMPKRMYI--HP 58


>AY600515-1|AAT11863.1|  134|Tribolium castaneum
           optomotor-blind-like protein protein.
          Length = 134

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = +3

Query: 468 ECVSEGDQEIRFRLSAWPVTFTADPEERQESWLQNHP 578
           + V+  D   +F  S W V   ADPE  +  ++  HP
Sbjct: 24  DIVAADDCRYKFHNSRWMVAGKADPEMPKRMYI--HP 58


>AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembrane
           transporter protein.
          Length = 669

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +3

Query: 585 KCANMDLPCLSEG 623
           +C N DLPC  +G
Sbjct: 613 QCPNADLPCPKDG 625


>AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembrane
           transporter white protein.
          Length = 669

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +3

Query: 585 KCANMDLPCLSEG 623
           +C N DLPC  +G
Sbjct: 613 QCPNADLPCPKDG 625


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,527
Number of Sequences: 336
Number of extensions: 3682
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17906060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -