BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060336.seq (685 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-... 23 2.3 AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 23 2.3 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 4.1 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 4.1 >AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-like protein protein. Length = 143 Score = 23.0 bits (47), Expect = 2.3 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 468 ECVSEGDQEIRFRLSAWPVTFTADPEERQESWLQNHP 578 + V+ D +F S W V ADPE + ++ HP Sbjct: 24 DIVAADDCRYKFHNSRWMVAGKADPEMPKRMYI--HP 58 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 23.0 bits (47), Expect = 2.3 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 468 ECVSEGDQEIRFRLSAWPVTFTADPEERQESWLQNHP 578 + V+ D +F S W V ADPE + ++ HP Sbjct: 24 DIVAADDCRYKFHNSRWMVAGKADPEMPKRMYI--HP 58 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 22.2 bits (45), Expect = 4.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 585 KCANMDLPCLSEG 623 +C N DLPC +G Sbjct: 613 QCPNADLPCPKDG 625 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.2 bits (45), Expect = 4.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 585 KCANMDLPCLSEG 623 +C N DLPC +G Sbjct: 613 QCPNADLPCPKDG 625 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,527 Number of Sequences: 336 Number of extensions: 3682 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -