BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060335.seq (665 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U55375-5|AAC69045.1| 126|Caenorhabditis elegans Profilin protei... 47 1e-05 AY530910-1|AAT01435.1| 126|Caenorhabditis elegans profilin-3 pr... 47 1e-05 U40941-2|AAA81708.3| 131|Caenorhabditis elegans Profilin protei... 33 0.24 AY530909-1|AAT01434.1| 131|Caenorhabditis elegans profilin-2 pr... 33 0.24 >U55375-5|AAC69045.1| 126|Caenorhabditis elegans Profilin protein 3 protein. Length = 126 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/56 (41%), Positives = 30/56 (53%) Frame = +3 Query: 81 MSWQDYVDKQLMASRCVTKAAIAGHDXNVWAKSEGFXISKDXVAKIVAGFENXSLL 248 MSW D ++ L+ S V+KAAI G D VWAKS+ F IS + F + L Sbjct: 1 MSWSDIINNNLIGSGNVSKAAILGFDGAVWAKSDNFNISVEEAVAAGKAFTSLDAL 56 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 325 GKVGVHCXKTQQAVVISLYEEPIQPQQXASVVEKLGXYLITCGY 456 G G KT QAV+IS+YE+ +QP+ + L Y + Y Sbjct: 83 GGSGFFIYKTIQAVIISIYEKGLQPEMCSKTTGALADYFRSIKY 126 >AY530910-1|AAT01435.1| 126|Caenorhabditis elegans profilin-3 protein. Length = 126 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/56 (41%), Positives = 30/56 (53%) Frame = +3 Query: 81 MSWQDYVDKQLMASRCVTKAAIAGHDXNVWAKSEGFXISKDXVAKIVAGFENXSLL 248 MSW D ++ L+ S V+KAAI G D VWAKS+ F IS + F + L Sbjct: 1 MSWSDIINNNLIGSGNVSKAAILGFDGAVWAKSDNFNISVEEAVAAGKAFTSLDAL 56 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 325 GKVGVHCXKTQQAVVISLYEEPIQPQQXASVVEKLGXYLITCGY 456 G G KT QAV+IS+YE+ +QP+ + L Y + Y Sbjct: 83 GGSGFFIYKTIQAVIISIYEKGLQPEMCSKTTGALADYFRSIKY 126 >U40941-2|AAA81708.3| 131|Caenorhabditis elegans Profilin protein 2 protein. Length = 131 Score = 32.7 bits (71), Expect = 0.24 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 87 WQDYVDKQLMASRCVTKAAIAGHDXNVWAKS 179 W DY+ S + +AAI G D +VWA+S Sbjct: 4 WDDYIKLLFGKSPAIKRAAIIGSDGSVWARS 34 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 328 KVGVHCXKTQQAVVISLYE-EPIQPQQXASVVEKLGXYLITCGY 456 + G KT QA+VI++YE + Q + VE + YL + GY Sbjct: 88 QTGFFAAKTNQAIVIAMYEGDNAQSASVRAGVEYIAQYLASSGY 131 >AY530909-1|AAT01434.1| 131|Caenorhabditis elegans profilin-2 protein. Length = 131 Score = 32.7 bits (71), Expect = 0.24 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 87 WQDYVDKQLMASRCVTKAAIAGHDXNVWAKS 179 W DY+ S + +AAI G D +VWA+S Sbjct: 4 WDDYIKLLFGKSPAIKRAAIIGSDGSVWARS 34 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 328 KVGVHCXKTQQAVVISLYE-EPIQPQQXASVVEKLGXYLITCGY 456 + G KT QA+VI++YE + Q + VE + YL + GY Sbjct: 88 QTGFFAAKTNQAIVIAMYEGDNAQSASVRAGVEYIAQYLASSGY 131 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,699,445 Number of Sequences: 27780 Number of extensions: 211667 Number of successful extensions: 314 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 314 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1497472076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -