BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060334.seq (687 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC026072-1|AAH26072.1| 370|Homo sapiens ubiquitin specific pept... 147 3e-35 AL355473-1|CAI16331.1| 370|Homo sapiens ubiquitin specific prot... 147 3e-35 AL158062-1|CAH70555.1| 370|Homo sapiens ubiquitin specific prot... 147 3e-35 AF022789-1|AAC23551.1| 355|Homo sapiens ubiquitin hydrolyzing e... 147 3e-35 BC037574-1|AAH37574.1| 366|Homo sapiens ubiquitin specific pept... 146 5e-35 AK024318-1|BAB14881.1| 366|Homo sapiens protein ( Homo sapiens ... 146 5e-35 AK022614-1|BAB14133.1| 366|Homo sapiens protein ( Homo sapiens ... 146 5e-35 AJ586137-1|CAE51937.1| 1017|Homo sapiens ubiquitin-specific prot... 48 3e-05 AB037793-1|BAA92610.1| 773|Homo sapiens KIAA1372 protein protein. 48 3e-05 BC068975-1|AAH68975.1| 1042|Homo sapiens ubiquitin specific pept... 47 7e-05 BC039115-1|AAH39115.1| 1004|Homo sapiens USP38 protein protein. 47 7e-05 AK057992-1|BAB71627.1| 706|Homo sapiens protein ( Homo sapiens ... 47 7e-05 AB067478-1|BAB67784.1| 780|Homo sapiens KIAA1891 protein protein. 47 7e-05 BC050525-1|AAH50525.1| 785|Homo sapiens ubiquitin specific pept... 46 1e-04 BC032364-1|AAH32364.1| 222|Homo sapiens USP1 protein protein. 46 1e-04 BC018745-1|AAH18745.1| 223|Homo sapiens Unknown (protein for IM... 46 1e-04 AF117386-1|AAD11441.1| 785|Homo sapiens ubiquitin-specific prot... 46 1e-04 AB014458-1|BAA34703.1| 785|Homo sapiens ubiquitin specific prot... 46 1e-04 Z72499-1|CAA96580.1| 1102|Homo sapiens herpesvirus associated ub... 45 2e-04 AY376241-1|AAQ82908.1| 1112|Homo sapiens ubiquitin-specific prot... 45 2e-04 BC016663-1|AAH16663.1| 828|Homo sapiens ubiquitin specific pept... 39 0.019 AK027362-1|BAB55063.1| 1287|Homo sapiens protein ( Homo sapiens ... 39 0.019 AK022864-1|BAB14279.1| 828|Homo sapiens protein ( Homo sapiens ... 39 0.019 Z81365-3|CAI43184.1| 913|Homo sapiens ubiquitin specific peptid... 38 0.025 BC101191-1|AAI01192.1| 913|Homo sapiens ubiquitin specific pept... 38 0.025 BC101190-1|AAI01191.1| 913|Homo sapiens ubiquitin specific pept... 38 0.025 BC101189-1|AAI01190.1| 913|Homo sapiens ubiquitin specific pept... 38 0.025 BC069073-1|AAH69073.1| 913|Homo sapiens ubiquitin specific pept... 38 0.025 BC067300-1|AAH67300.1| 350|Homo sapiens USP40 protein protein. 38 0.025 BC004868-1|AAH04868.1| 508|Homo sapiens ubiquitin specific pept... 38 0.025 AK027820-1|BAB55392.1| 486|Homo sapiens protein ( Homo sapiens ... 38 0.025 AJ586136-1|CAE51936.1| 517|Homo sapiens ubiquitin-specific prot... 38 0.025 AJ583821-1|CAE47748.2| 1247|Homo sapiens ubiquitin specific prot... 38 0.025 AF383173-1|AAL78315.1| 911|Homo sapiens pVHL-interacting deubiq... 38 0.025 AF383172-1|AAL78314.1| 942|Homo sapiens pVHL-interacting deubiq... 38 0.025 AF285593-1|AAK31972.1| 913|Homo sapiens ubiquitin specific prot... 38 0.025 AB029020-1|BAA83049.1| 980|Homo sapiens KIAA1097 protein protein. 38 0.025 BC039593-1|AAH39593.1| 913|Homo sapiens ubiquitin specific pept... 38 0.034 AY074877-1|AAL79676.1| 913|Homo sapiens pVHL-interacting deubiq... 38 0.034 AL158207-6|CAC88170.1| 914|Homo sapiens ubiquitin specific pept... 38 0.034 AB023220-1|BAA76847.2| 917|Homo sapiens KIAA1003 protein protein. 38 0.034 BC014176-1|AAH14176.1| 640|Homo sapiens ubiquitin specific pept... 38 0.044 AL365205-13|CAI13188.1| 640|Homo sapiens ubiquitin specific pep... 38 0.044 AL365205-12|CAI13186.1| 585|Homo sapiens ubiquitin specific pep... 38 0.044 AL365205-11|CAI13187.1| 688|Homo sapiens ubiquitin specific pep... 38 0.044 AJ586139-1|CAE51939.1| 688|Homo sapiens ubiquitin-specific prot... 38 0.044 BC075792-1|AAH75792.1| 1055|Homo sapiens ubiquitin specific pept... 37 0.059 BC015930-1|AAH15930.1| 450|Homo sapiens USP25 protein protein. 37 0.059 AF170562-1|AAF32263.1| 1087|Homo sapiens ubiquitin-specific proc... 37 0.059 AF134213-1|AAF24998.1| 1055|Homo sapiens ubiquitin-specific prot... 37 0.059 Y13619-1|CAA73941.1| 2070|Homo sapiens DFFRY protein. 37 0.077 Y13618-1|CAA73940.1| 2555|Homo sapiens DFFRY protein. 37 0.077 AF000986-1|AAC51833.1| 2555|Homo sapiens ubiquitin specific prot... 37 0.077 BC146752-1|AAI46753.1| 1318|Homo sapiens ubiquitin specific pept... 36 0.10 BC142727-1|AAI42728.1| 1449|Homo sapiens USP19 protein protein. 36 0.10 BC142660-1|AAI42661.1| 1447|Homo sapiens USP19 protein protein. 36 0.10 BC106029-1|AAI06030.1| 799|Homo sapiens USP19 protein protein. 36 0.10 BC082241-1|AAH82241.1| 1179|Homo sapiens USP19 protein protein. 36 0.10 AB020698-1|BAA74914.1| 1371|Homo sapiens KIAA0891 protein protein. 36 0.10 X98296-1|CAA66942.1| 2547|Homo sapiens ubiquitin hydrolase protein. 36 0.14 BC090946-1|AAH90946.1| 565|Homo sapiens ubiquitin specific pept... 36 0.14 BC003130-1|AAH03130.2| 477|Homo sapiens USP21 protein protein. 36 0.14 AL590714-3|CAH72142.1| 551|Homo sapiens ubiquitin specific pept... 36 0.14 AL590714-2|CAH72143.1| 565|Homo sapiens ubiquitin specific pept... 36 0.14 AL391259-2|CAD13527.2| 2547|Homo sapiens ubiquitin specific pept... 36 0.14 AL157417-1|CAB75649.1| 268|Homo sapiens hypothetical protein pr... 36 0.14 AL109797-1|CAD18900.2| 2547|Homo sapiens ubiquitin specific pept... 36 0.14 AJ583823-1|CAE47750.2| 711|Homo sapiens ubiquitin specific prot... 36 0.14 AF233442-1|AAF61308.1| 381|Homo sapiens NEDD8-specific protease... 36 0.14 AF177758-1|AAD54321.1| 565|Homo sapiens ubiquitin specific prot... 36 0.14 AB208899-1|BAD92136.1| 410|Homo sapiens ubiquitin-specific prot... 36 0.14 X91349-1|CAA62690.1| 858|Homo sapiens de-ubiquitinase protein. 36 0.18 U47927-1|AAC50465.1| 858|Homo sapiens isopeptidase T protein. 36 0.18 U47924-8|AAB51314.1| 835|Homo sapiens isopeptidase T protein. 36 0.18 U47924-7|AAB51315.1| 858|Homo sapiens isopeptidase T protein. 36 0.18 U35116-1|AAA78934.1| 835|Homo sapiens ubiquitin isopeptidase T ... 36 0.18 BC005139-1|AAH05139.1| 858|Homo sapiens USP5 protein protein. 36 0.18 BC004889-1|AAH04889.1| 835|Homo sapiens ubiquitin specific pept... 36 0.18 AL831918-1|CAD38579.1| 810|Homo sapiens hypothetical protein pr... 36 0.18 AJ586138-1|CAE51938.1| 3395|Homo sapiens ubiquitin-specific prot... 36 0.18 AB011142-1|BAA25496.2| 3412|Homo sapiens KIAA0570 protein protein. 36 0.18 BC133009-1|AAI33010.1| 979|Homo sapiens ubiquitin specific pept... 35 0.24 BC133007-1|AAI33008.1| 979|Homo sapiens USP37 protein protein. 35 0.24 BC112901-1|AAI12902.1| 885|Homo sapiens USP37 protein protein. 35 0.24 BC030704-1|AAH30704.1| 712|Homo sapiens ubiquitin specific pept... 35 0.24 AL832645-1|CAD89955.1| 979|Homo sapiens hypothetical protein pr... 35 0.24 AB046814-1|BAB13420.1| 931|Homo sapiens KIAA1594 protein protein. 35 0.24 U20657-1|AAB72237.1| 963|Homo sapiens ubiquitin protease protein. 35 0.31 BC125131-1|AAI25132.1| 963|Homo sapiens ubiquitin specific pept... 35 0.31 BC125130-1|AAI25131.1| 963|Homo sapiens ubiquitin specific pept... 35 0.31 AK223292-1|BAD97012.1| 963|Homo sapiens ubiquitin specific prot... 35 0.31 AK222725-1|BAD96445.1| 916|Homo sapiens ubiquitin specific prot... 35 0.31 AF017306-1|AAC27356.1| 916|Homo sapiens UnpES protein. 35 0.31 AF017305-1|AAC27355.1| 963|Homo sapiens UnpEL protein. 35 0.31 D80012-1|BAA11507.1| 813|Homo sapiens KIAA0190 protein. 34 0.41 BX537402-1|CAD97644.1| 824|Homo sapiens hypothetical protein pr... 34 0.41 BC130398-1|AAI30399.1| 912|Homo sapiens USP29 protein protein. 34 0.41 BC130394-1|AAI30395.1| 912|Homo sapiens USP29 protein protein. 34 0.41 BC041366-1|AAH41366.1| 362|Homo sapiens USP2 protein protein. 34 0.41 BC002955-1|AAH02955.1| 605|Homo sapiens ubiquitin specific pept... 34 0.41 BC002854-1|AAH02854.1| 605|Homo sapiens ubiquitin specific pept... 34 0.41 BC000263-1|AAH00263.1| 798|Homo sapiens ubiquitin specific pept... 34 0.41 AK057225-1|BAB71388.1| 605|Homo sapiens protein ( Homo sapiens ... 34 0.41 AF440755-1|AAN65363.1| 396|Homo sapiens ubiquitin specific prot... 34 0.41 AF229438-1|AAG10401.1| 922|Homo sapiens ubiquitin-specific proc... 34 0.41 AF079564-1|AAC28392.1| 353|Homo sapiens ubiquitin-specific prot... 34 0.41 BC132862-1|AAI32863.1| 1316|Homo sapiens ubiquitin specific pept... 34 0.55 BC060846-1|AAH60846.2| 1202|Homo sapiens USP42 protein protein. 34 0.55 AY618868-1|AAT67238.1| 1324|Homo sapiens ubiquitin specific prot... 34 0.55 AK022759-1|BAB14232.1| 1198|Homo sapiens protein ( Homo sapiens ... 34 0.55 AJ601395-1|CAE53097.1| 1325|Homo sapiens ubiquitin-specific prot... 34 0.55 U75362-1|AAC63405.1| 863|Homo sapiens isopeptidase T-3 protein. 33 0.95 BC125123-1|AAI25124.1| 952|Homo sapiens ubiquitin specific pept... 33 0.95 BC016146-1|AAH16146.1| 863|Homo sapiens ubiquitin specific pept... 33 0.95 AY509884-1|AAR91701.1| 530|Homo sapiens deubiquitinating enzyme... 33 0.95 AF153604-1|AAD41086.1| 981|Homo sapiens ubiquitin-specific prot... 33 0.95 AF106069-1|AAD52099.1| 952|Homo sapiens deubiquitinating enzyme... 33 0.95 AF013990-1|AAG28973.1| 902|Homo sapiens ubiquitin C-terminal hy... 33 0.95 AB011101-1|BAA25455.2| 952|Homo sapiens KIAA0529 protein protein. 33 0.95 D29956-1|BAA06225.2| 1120|Homo sapiens KIAA0055 protein. 33 1.3 BX538024-1|CAD97970.1| 979|Homo sapiens hypothetical protein pr... 33 1.3 BX537420-1|CAD97662.1| 1118|Homo sapiens hypothetical protein pr... 33 1.3 BC110590-1|AAI10591.1| 1118|Homo sapiens ubiquitin specific pept... 33 1.3 U30888-1|AAB60365.1| 494|Homo sapiens tRNA-Guanine Transglycosy... 32 1.7 BX640815-1|CAE45893.1| 453|Homo sapiens hypothetical protein pr... 32 1.7 BT007183-1|AAP35847.1| 494|Homo sapiens ubiquitin specific prot... 32 1.7 BC126898-1|AAI26899.1| 513|Homo sapiens USP22 protein protein. 32 1.7 BC110499-1|AAI10500.1| 512|Homo sapiens USP22 protein protein. 32 1.7 BC003556-1|AAH03556.1| 494|Homo sapiens ubiquitin specific pept... 32 1.7 AY533200-1|AAS59847.1| 398|Homo sapiens deubiquitinating enzyme... 32 1.7 AY188990-1|AAO38845.1| 530|Homo sapiens deubiquitinating enzyme... 32 1.7 AK098514-1|BAC05320.1| 157|Homo sapiens protein ( Homo sapiens ... 32 1.7 AF544012-1|AAQ11742.1| 530|Homo sapiens deubiquitinating enzyme... 32 1.7 AF544011-1|AAQ11741.1| 530|Homo sapiens deubiquitinating enzyme... 32 1.7 AB028986-1|BAA83015.1| 593|Homo sapiens KIAA1063 protein protein. 32 1.7 BT007269-1|AAP35933.1| 520|Homo sapiens ubiquitin specific prot... 32 2.2 BC107138-1|AAI07139.1| 520|Homo sapiens ubiquitin specific pept... 32 2.2 BC107137-1|AAI07138.1| 520|Homo sapiens ubiquitin specific pept... 32 2.2 BC100029-1|AAI00030.1| 393|Homo sapiens USP3 protein protein. 32 2.2 BC071582-1|AAH71582.1| 1123|Homo sapiens USP36 protein protein. 32 2.2 BC065300-1|AAH65300.1| 520|Homo sapiens ubiquitin specific pept... 32 2.2 BC038983-1|AAH38983.1| 285|Homo sapiens USP36 protein protein. 32 2.2 BC027992-1|AAH27992.1| 959|Homo sapiens USP36 protein protein. 32 2.2 BC018113-1|AAH18113.1| 520|Homo sapiens ubiquitin specific pept... 32 2.2 BC016487-1|AAH16487.1| 963|Homo sapiens Unknown (protein for IM... 32 2.2 AY461579-1|AAT37507.1| 498|Homo sapiens UBP protein protein. 32 2.2 AY169386-1|AAO34133.1| 548|Homo sapiens deubiquitinating enzyme... 32 2.2 AK022913-1|BAB14306.1| 548|Homo sapiens protein ( Homo sapiens ... 32 2.2 AK001671-1|BAA91825.1| 954|Homo sapiens protein ( Homo sapiens ... 32 2.2 AF073344-1|AAD42992.1| 521|Homo sapiens ubiquitin-specific prot... 32 2.2 AB040886-1|BAA95977.1| 1123|Homo sapiens KIAA1453 protein protein. 32 2.2 X63547-2|CAA45111.1| 1089|Homo sapiens oncogene protein. 31 2.9 X63546-1|CAA45108.1| 786|Homo sapiens oncogene protein. 31 2.9 AY143550-1|AAN38838.1| 1406|Homo sapiens ubiquitin-specific prot... 31 2.9 U44839-1|AAC50450.1| 690|Homo sapiens UHX1 protein protein. 31 3.8 BC063668-1|AAH63668.1| 923|Homo sapiens USP11 protein protein. 31 3.8 BC030777-1|AAH30777.1| 822|Homo sapiens ubiquitin specific pept... 31 3.8 BC000350-1|AAH00350.4| 921|Homo sapiens USP11 protein protein. 31 3.8 AY333928-1|AAR13293.1| 408|Homo sapiens USP16 protein. 31 3.8 AL163249-3|CAB90432.1| 823|Homo sapiens human ubiquitin process... 31 3.8 AL096791-3|CAD20056.1| 690|Homo sapiens ubiquitin specific pept... 31 3.8 AL096791-2|CAI42996.1| 140|Homo sapiens ubiquitin specific pept... 31 3.8 AK222884-1|BAD96604.1| 823|Homo sapiens ubiquitin specific prot... 31 3.8 AK222681-1|BAD96401.1| 823|Homo sapiens ubiquitin specific prot... 31 3.8 AK127075-1|BAC86814.1| 1332|Homo sapiens protein ( Homo sapiens ... 31 3.8 AF126736-1|AAD20949.1| 823|Homo sapiens ubiquitin processing pr... 31 3.8 AB073597-1|BAC20463.1| 921|Homo sapiens deubiquitinating enzyme... 31 3.8 AB028980-1|BAA83009.1| 977|Homo sapiens KIAA1057 protein protein. 31 3.8 AK127803-1|BAC87142.1| 1063|Homo sapiens protein ( Homo sapiens ... 31 5.1 AF533230-1|AAM97922.1| 1604|Homo sapiens ubiquitin-specific prot... 31 5.1 AF350251-1|AAK30207.1| 1274|Homo sapiens ubiquitin specific prot... 31 5.1 AF155116-1|AAD42882.1| 828|Homo sapiens NY-REN-60 antigen protein. 31 5.1 >BC026072-1|AAH26072.1| 370|Homo sapiens ubiquitin specific peptidase 12 protein. Length = 370 Score = 147 bits (357), Expect = 3e-35 Identities = 70/84 (83%), Positives = 74/84 (88%) Frame = +1 Query: 253 PPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSI 432 P NEHYFGLVNFGNTCY NSVLQALYFCRPFREKVL YK++ R KE+LLTCLADLF+SI Sbjct: 33 PVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQ-PRKKESLLTCLADLFHSI 91 Query: 433 ATQKKKVGSIAPKKFIARLRKEKE 504 ATQKKKVG I PKKFI RLRKE E Sbjct: 92 ATQKKKVGVIPPKKFITRLRKENE 115 Score = 53.6 bits (123), Expect = 6e-07 Identities = 27/59 (45%), Positives = 37/59 (62%) Frame = +3 Query: 510 DNYMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTCNGFSASQTLNPTWV 686 DNYMQQDAHEFLN+L+N I +I+ ER Q ++N N + + + T +PTWV Sbjct: 118 DNYMQQDAHEFLNYLLNTIADILQEERKQE----KQNGRLPNGNIDNENNNSTPDPTWV 172 >AL355473-1|CAI16331.1| 370|Homo sapiens ubiquitin specific protease 12 like 1 protein. Length = 370 Score = 147 bits (357), Expect = 3e-35 Identities = 70/84 (83%), Positives = 74/84 (88%) Frame = +1 Query: 253 PPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSI 432 P NEHYFGLVNFGNTCY NSVLQALYFCRPFREKVL YK++ R KE+LLTCLADLF+SI Sbjct: 33 PVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQ-PRKKESLLTCLADLFHSI 91 Query: 433 ATQKKKVGSIAPKKFIARLRKEKE 504 ATQKKKVG I PKKFI RLRKE E Sbjct: 92 ATQKKKVGVIPPKKFITRLRKENE 115 Score = 53.6 bits (123), Expect = 6e-07 Identities = 27/59 (45%), Positives = 37/59 (62%) Frame = +3 Query: 510 DNYMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTCNGFSASQTLNPTWV 686 DNYMQQDAHEFLN+L+N I +I+ ER Q ++N N + + + T +PTWV Sbjct: 118 DNYMQQDAHEFLNYLLNTIADILQEERKQE----KQNGRLPNGNIDNENNNSTPDPTWV 172 >AL158062-1|CAH70555.1| 370|Homo sapiens ubiquitin specific protease 12 like 1 protein. Length = 370 Score = 147 bits (357), Expect = 3e-35 Identities = 70/84 (83%), Positives = 74/84 (88%) Frame = +1 Query: 253 PPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSI 432 P NEHYFGLVNFGNTCY NSVLQALYFCRPFREKVL YK++ R KE+LLTCLADLF+SI Sbjct: 33 PVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQ-PRKKESLLTCLADLFHSI 91 Query: 433 ATQKKKVGSIAPKKFIARLRKEKE 504 ATQKKKVG I PKKFI RLRKE E Sbjct: 92 ATQKKKVGVIPPKKFITRLRKENE 115 Score = 53.6 bits (123), Expect = 6e-07 Identities = 27/59 (45%), Positives = 37/59 (62%) Frame = +3 Query: 510 DNYMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTCNGFSASQTLNPTWV 686 DNYMQQDAHEFLN+L+N I +I+ ER Q ++N N + + + T +PTWV Sbjct: 118 DNYMQQDAHEFLNYLLNTIADILQEERKQE----KQNGRLPNGNIDNENNNSTPDPTWV 172 >AF022789-1|AAC23551.1| 355|Homo sapiens ubiquitin hydrolyzing enzyme I protein. Length = 355 Score = 147 bits (357), Expect = 3e-35 Identities = 70/84 (83%), Positives = 74/84 (88%) Frame = +1 Query: 253 PPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSI 432 P NEHYFGLVNFGNTCY NSVLQALYFCRPFREKVL YK++ R KE+LLTCLADLF+SI Sbjct: 18 PVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQ-PRKKESLLTCLADLFHSI 76 Query: 433 ATQKKKVGSIAPKKFIARLRKEKE 504 ATQKKKVG I PKKFI RLRKE E Sbjct: 77 ATQKKKVGVIPPKKFITRLRKENE 100 Score = 53.6 bits (123), Expect = 6e-07 Identities = 27/59 (45%), Positives = 37/59 (62%) Frame = +3 Query: 510 DNYMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTCNGFSASQTLNPTWV 686 DNYMQQDAHEFLN+L+N I +I+ ER Q ++N N + + + T +PTWV Sbjct: 103 DNYMQQDAHEFLNYLLNTIADILQEERKQE----KQNGRLPNGNIDNENNNSTPDPTWV 157 >BC037574-1|AAH37574.1| 366|Homo sapiens ubiquitin specific peptidase 46 protein. Length = 366 Score = 146 bits (355), Expect = 5e-35 Identities = 69/84 (82%), Positives = 74/84 (88%) Frame = +1 Query: 253 PPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSI 432 P NEHYFGLVNFGNTCY NSVLQALYFCRPFRE VL YKA+ K+ KE LLTCLADLF+SI Sbjct: 29 PINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLAYKAQQKK-KENLLTCLADLFHSI 87 Query: 433 ATQKKKVGSIAPKKFIARLRKEKE 504 ATQKKKVG I PKKFI+RLRKE + Sbjct: 88 ATQKKKVGVIPPKKFISRLRKEND 111 Score = 48.0 bits (109), Expect = 3e-05 Identities = 25/59 (42%), Positives = 35/59 (59%) Frame = +3 Query: 510 DNYMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTCNGFSASQTLNPTWV 686 DNYMQQDAHEFLN+L+N I +I+ E+ Q ++N +N N + + TWV Sbjct: 114 DNYMQQDAHEFLNYLLNTIADILQEEKKQE----KQNGKLKNGNMNEPAENNKPELTWV 168 >AK024318-1|BAB14881.1| 366|Homo sapiens protein ( Homo sapiens cDNA FLJ14256 fis, clone PLACE1000007, weakly similar to PROBABLE UBIQUITIN CARBOXYL-TERMINAL HYDROLASE R10E11.3 (EC ). Length = 366 Score = 146 bits (355), Expect = 5e-35 Identities = 69/84 (82%), Positives = 74/84 (88%) Frame = +1 Query: 253 PPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSI 432 P NEHYFGLVNFGNTCY NSVLQALYFCRPFRE VL YKA+ K+ KE LLTCLADLF+SI Sbjct: 29 PINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLAYKAQQKK-KENLLTCLADLFHSI 87 Query: 433 ATQKKKVGSIAPKKFIARLRKEKE 504 ATQKKKVG I PKKFI+RLRKE + Sbjct: 88 ATQKKKVGVIPPKKFISRLRKEND 111 Score = 48.0 bits (109), Expect = 3e-05 Identities = 25/59 (42%), Positives = 35/59 (59%) Frame = +3 Query: 510 DNYMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTCNGFSASQTLNPTWV 686 DNYMQQDAHEFLN+L+N I +I+ E+ Q ++N +N N + + TWV Sbjct: 114 DNYMQQDAHEFLNYLLNTIADILQEEKKQE----KQNGKLKNGNMNEPAENNKPELTWV 168 >AK022614-1|BAB14133.1| 366|Homo sapiens protein ( Homo sapiens cDNA FLJ12552 fis, clone NT2RM4000712, moderately similar to Homo sapiens ubiquitin hydrolyzing enzyme I (UBH1) mRNA. ). Length = 366 Score = 146 bits (355), Expect = 5e-35 Identities = 69/84 (82%), Positives = 74/84 (88%) Frame = +1 Query: 253 PPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSI 432 P NEHYFGLVNFGNTCY NSVLQALYFCRPFRE VL YKA+ K+ KE LLTCLADLF+SI Sbjct: 29 PINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLAYKAQQKK-KENLLTCLADLFHSI 87 Query: 433 ATQKKKVGSIAPKKFIARLRKEKE 504 ATQKKKVG I PKKFI+RLRKE + Sbjct: 88 ATQKKKVGVIPPKKFISRLRKEND 111 Score = 48.0 bits (109), Expect = 3e-05 Identities = 25/59 (42%), Positives = 35/59 (59%) Frame = +3 Query: 510 DNYMQQDAHEFLNFLINHINEIILAERNQSTLKVQKNNSGENVTCNGFSASQTLNPTWV 686 DNYMQQDAHEFLN+L+N I +I+ E+ Q ++N +N N + + TWV Sbjct: 114 DNYMQQDAHEFLNYLLNTIADILQEEKKQE----KQNGKLKNGNMNEPAENNKPELTWV 168 >AJ586137-1|CAE51937.1| 1017|Homo sapiens ubiquitin-specific proteinase 35 protein. Length = 1017 Score = 48.0 bits (109), Expect = 3e-05 Identities = 27/70 (38%), Positives = 40/70 (57%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 GL+N GNTCY NS+LQAL+ FR VL N + L+T L LF + ++ Sbjct: 441 GLINLGNTCYVNSILQALFMASEFRHCVLRLTENN---SQPLMTKLQWLFGFLEHSQRP- 496 Query: 454 GSIAPKKFIA 483 +I+P+ F++ Sbjct: 497 -AISPENFLS 505 >AB037793-1|BAA92610.1| 773|Homo sapiens KIAA1372 protein protein. Length = 773 Score = 48.0 bits (109), Expect = 3e-05 Identities = 27/70 (38%), Positives = 40/70 (57%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 GL+N GNTCY NS+LQAL+ FR VL N + L+T L LF + ++ Sbjct: 197 GLINLGNTCYVNSILQALFMASDFRHCVLRLTENN---SQPLMTKLQWLFGFLEHSQRP- 252 Query: 454 GSIAPKKFIA 483 +I+P+ F++ Sbjct: 253 -AISPENFLS 261 >BC068975-1|AAH68975.1| 1042|Homo sapiens ubiquitin specific peptidase 38 protein. Length = 1042 Score = 46.8 bits (106), Expect = 7e-05 Identities = 28/73 (38%), Positives = 41/73 (56%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 GL+N GNTCY NSV+QAL+ FR +VL + N +L+ L LF +A +++ Sbjct: 446 GLINLGNTCYMNSVIQALFMATDFRRQVL---SLNLNGCNSLMKKLQHLFAFLAHTQRE- 501 Query: 454 GSIAPKKFIARLR 492 + AP+ F R Sbjct: 502 -AYAPRIFFEASR 513 >BC039115-1|AAH39115.1| 1004|Homo sapiens USP38 protein protein. Length = 1004 Score = 46.8 bits (106), Expect = 7e-05 Identities = 28/73 (38%), Positives = 41/73 (56%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 GL+N GNTCY NSV+QAL+ FR +VL + N +L+ L LF +A +++ Sbjct: 446 GLINLGNTCYMNSVIQALFMATDFRRQVL---SLNLNGCNSLMKKLQHLFAFLAHTQRE- 501 Query: 454 GSIAPKKFIARLR 492 + AP+ F R Sbjct: 502 -AYAPRIFFEASR 513 >AK057992-1|BAB71627.1| 706|Homo sapiens protein ( Homo sapiens cDNA FLJ25263 fis, clone STM05053. ). Length = 706 Score = 46.8 bits (106), Expect = 7e-05 Identities = 28/73 (38%), Positives = 41/73 (56%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 GL+N GNTCY NSV+QAL+ FR +VL + N +L+ L LF +A +++ Sbjct: 110 GLINLGNTCYMNSVIQALFMATDFRRQVL---SLNLNGCNSLMKKLQHLFAFLAHTQRE- 165 Query: 454 GSIAPKKFIARLR 492 + AP+ F R Sbjct: 166 -AYAPRIFFEASR 177 >AB067478-1|BAB67784.1| 780|Homo sapiens KIAA1891 protein protein. Length = 780 Score = 46.8 bits (106), Expect = 7e-05 Identities = 28/73 (38%), Positives = 41/73 (56%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 GL+N GNTCY NSV+QAL+ FR +VL + N +L+ L LF +A +++ Sbjct: 184 GLINLGNTCYMNSVIQALFMATDFRRQVL---SLNLNGCNSLMKKLQHLFAFLAHTQRE- 239 Query: 454 GSIAPKKFIARLR 492 + AP+ F R Sbjct: 240 -AYAPRIFFEASR 251 >BC050525-1|AAH50525.1| 785|Homo sapiens ubiquitin specific peptidase 1 protein. Length = 785 Score = 46.0 bits (104), Expect = 1e-04 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETL 399 + GL N GNTCY NS+LQ LYFC F+ V R KE L Sbjct: 80 FVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEAL 123 >BC032364-1|AAH32364.1| 222|Homo sapiens USP1 protein protein. Length = 222 Score = 46.0 bits (104), Expect = 1e-04 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETL 399 + GL N GNTCY NS+LQ LYFC F+ V R KE L Sbjct: 80 FVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEAL 123 >BC018745-1|AAH18745.1| 223|Homo sapiens Unknown (protein for IMAGE:4649027) protein. Length = 223 Score = 46.0 bits (104), Expect = 1e-04 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETL 399 + GL N GNTCY NS+LQ LYFC F+ V R KE L Sbjct: 80 FVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEAL 123 >AF117386-1|AAD11441.1| 785|Homo sapiens ubiquitin-specific protease protein. Length = 785 Score = 46.0 bits (104), Expect = 1e-04 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETL 399 + GL N GNTCY NS+LQ LYFC F+ V R KE L Sbjct: 80 FVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEAL 123 >AB014458-1|BAA34703.1| 785|Homo sapiens ubiquitin specific protease protein. Length = 785 Score = 46.0 bits (104), Expect = 1e-04 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETL 399 + GL N GNTCY NS+LQ LYFC F+ V R KE L Sbjct: 80 FVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEAL 123 >Z72499-1|CAA96580.1| 1102|Homo sapiens herpesvirus associated ubiquitin-specific protease (HAUSP) protein. Length = 1102 Score = 45.2 bits (102), Expect = 2e-04 Identities = 22/64 (34%), Positives = 33/64 (51%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKK 447 Y GL N G TCY NS+LQ L+F R+ V + + +++ L +FY + K Sbjct: 213 YVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDK 272 Query: 448 KVGS 459 VG+ Sbjct: 273 PVGT 276 >AY376241-1|AAQ82908.1| 1112|Homo sapiens ubiquitin-specific protease 7 isoform protein. Length = 1112 Score = 45.2 bits (102), Expect = 2e-04 Identities = 22/64 (34%), Positives = 33/64 (51%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKK 447 Y GL N G TCY NS+LQ L+F R+ V + + +++ L +FY + K Sbjct: 223 YVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDK 282 Query: 448 KVGS 459 VG+ Sbjct: 283 PVGT 286 >BC016663-1|AAH16663.1| 828|Homo sapiens ubiquitin specific peptidase 33 protein. Length = 828 Score = 38.7 bits (86), Expect = 0.019 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADL-FYSIATQKKK 450 GL N GNTCY N+ LQAL C P + L+ + K+ + C + L + K + Sbjct: 186 GLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAI-CKSYLKLMTELWHKSR 244 Query: 451 VGSIAP 468 GS+ P Sbjct: 245 PGSVVP 250 >AK027362-1|BAB55063.1| 1287|Homo sapiens protein ( Homo sapiens cDNA FLJ14456 fis, clone HEMBB1001915, moderately similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 64E (EC 3.1.2.15). ). Length = 1287 Score = 38.7 bits (86), Expect = 0.019 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTC----LADLFYSIA 435 Y GLVN TCY NS+LQ L+ FR + YK + + ++E +T L LF + Sbjct: 99 YVGLVNQAMTCYLNSLLQTLFMTPEFRNAL--YKWEFEESEEDPVTSIPYQLQRLFVLLQ 156 Query: 436 TQKKK 450 T KK+ Sbjct: 157 TSKKR 161 >AK022864-1|BAB14279.1| 828|Homo sapiens protein ( Homo sapiens cDNA FLJ12802 fis, clone NT2RP2002124, weakly similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4 (EC 3.1.2.15). ). Length = 828 Score = 38.7 bits (86), Expect = 0.019 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADL-FYSIATQKKK 450 GL N GNTCY N+ LQAL C P + L+ + K+ + C + L + K + Sbjct: 186 GLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAI-CKSYLKLMTELWHKSR 244 Query: 451 VGSIAP 468 GS+ P Sbjct: 245 PGSVVP 250 >Z81365-3|CAI43184.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 38.3 bits (85), Expect = 0.025 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +1 Query: 256 PNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTCLADLFY 426 P + GL N GNTCY N+VLQ+L F + +L K L CLA L + Sbjct: 290 PEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLF 347 >BC101191-1|AAI01192.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 38.3 bits (85), Expect = 0.025 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +1 Query: 256 PNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTCLADLFY 426 P + GL N GNTCY N+VLQ+L F + +L K L CLA L + Sbjct: 290 PEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLF 347 >BC101190-1|AAI01191.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 38.3 bits (85), Expect = 0.025 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +1 Query: 256 PNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTCLADLFY 426 P + GL N GNTCY N+VLQ+L F + +L K L CLA L + Sbjct: 290 PEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLF 347 >BC101189-1|AAI01190.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 38.3 bits (85), Expect = 0.025 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +1 Query: 256 PNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTCLADLFY 426 P + GL N GNTCY N+VLQ+L F + +L K L CLA L + Sbjct: 290 PEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLF 347 >BC069073-1|AAH69073.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 38.3 bits (85), Expect = 0.025 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +1 Query: 256 PNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTCLADLFY 426 P + GL N GNTCY N+VLQ+L F + +L K L CLA L + Sbjct: 290 PEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLF 347 >BC067300-1|AAH67300.1| 350|Homo sapiens USP40 protein protein. Length = 350 Score = 38.3 bits (85), Expect = 0.025 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 5/47 (10%) Frame = +1 Query: 226 GKRYRVRAV-PPNEHYF----GLVNFGNTCYSNSVLQALYFCRPFRE 351 GK+ + +A+ PP F G+ N G TCY NS+LQ L+F FRE Sbjct: 53 GKKLKTKALEPPAPREFTNLSGIRNQGGTCYLNSLLQTLHFTPEFRE 99 >BC004868-1|AAH04868.1| 508|Homo sapiens ubiquitin specific peptidase 30 protein. Length = 508 Score = 38.3 bits (85), Expect = 0.025 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKE 393 GLVN GNTC+ NS+LQ L C F + E+ ++ R ++ Sbjct: 60 GLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQK 99 >AK027820-1|BAB55392.1| 486|Homo sapiens protein ( Homo sapiens cDNA FLJ14914 fis, clone PLACE1006829, weakly similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4 (EC 3.1.2.15). ). Length = 486 Score = 38.3 bits (85), Expect = 0.025 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKE 393 GLVN GNTC+ NS+LQ L C F + E+ ++ R ++ Sbjct: 38 GLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQK 77 >AJ586136-1|CAE51936.1| 517|Homo sapiens ubiquitin-specific proteinase 30 protein. Length = 517 Score = 38.3 bits (85), Expect = 0.025 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKE 393 GLVN GNTC+ NS+LQ L C F + E+ ++ R ++ Sbjct: 69 GLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQK 108 >AJ583821-1|CAE47748.2| 1247|Homo sapiens ubiquitin specific proteinase 40 protein. Length = 1247 Score = 38.3 bits (85), Expect = 0.025 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 5/47 (10%) Frame = +1 Query: 226 GKRYRVRAV-PPNEHYF----GLVNFGNTCYSNSVLQALYFCRPFRE 351 GK+ + +A+ PP F G+ N G TCY NS+LQ L+F FRE Sbjct: 33 GKKLKTKALEPPAPREFTNLSGIRNQGGTCYLNSLLQTLHFTPEFRE 79 >AF383173-1|AAL78315.1| 911|Homo sapiens pVHL-interacting deubiquitinating enzyme 1 type II protein. Length = 911 Score = 38.3 bits (85), Expect = 0.025 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADL-FYSIATQKKK 450 GL N GNTCY N+ LQAL C P + L+ + K+ + C + L + K + Sbjct: 155 GLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAI-CKSYLKLMTELWYKSR 213 Query: 451 VGSIAP 468 GS+ P Sbjct: 214 PGSVVP 219 >AF383172-1|AAL78314.1| 942|Homo sapiens pVHL-interacting deubiquitinating enzyme 1 type I protein. Length = 942 Score = 38.3 bits (85), Expect = 0.025 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADL-FYSIATQKKK 450 GL N GNTCY N+ LQAL C P + L+ + K+ + C + L + K + Sbjct: 186 GLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAI-CKSYLKLMTELWYKSR 244 Query: 451 VGSIAP 468 GS+ P Sbjct: 245 PGSVVP 250 >AF285593-1|AAK31972.1| 913|Homo sapiens ubiquitin specific protease 26 protein. Length = 913 Score = 38.3 bits (85), Expect = 0.025 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +1 Query: 256 PNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTCLADLFY 426 P + GL N GNTCY N+VLQ+L F + +L K L CLA L + Sbjct: 290 PEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLF 347 >AB029020-1|BAA83049.1| 980|Homo sapiens KIAA1097 protein protein. Length = 980 Score = 38.3 bits (85), Expect = 0.025 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADL-FYSIATQKKK 450 GL N GNTCY N+ LQAL C P + L+ + K+ + C + L + K + Sbjct: 224 GLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAI-CKSYLKLMTELWYKSR 282 Query: 451 VGSIAP 468 GS+ P Sbjct: 283 PGSVVP 288 >BC039593-1|AAH39593.1| 913|Homo sapiens ubiquitin specific peptidase 20 protein. Length = 913 Score = 37.9 bits (84), Expect = 0.034 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 G+ N GN+CY N+ LQAL C P + LE + K+ L S KK+ Sbjct: 146 GMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRP 205 Query: 454 GSIAP 468 + P Sbjct: 206 SYVVP 210 >AY074877-1|AAL79676.1| 913|Homo sapiens pVHL-interacting deubiquitinating enzyme 2 protein. Length = 913 Score = 37.9 bits (84), Expect = 0.034 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 G+ N GN+CY N+ LQAL C P + LE + K+ L S KK+ Sbjct: 146 GMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRP 205 Query: 454 GSIAP 468 + P Sbjct: 206 SYVVP 210 >AL158207-6|CAC88170.1| 914|Homo sapiens ubiquitin specific peptidase 20 protein. Length = 914 Score = 37.9 bits (84), Expect = 0.034 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 G+ N GN+CY N+ LQAL C P + LE + K+ L S KK+ Sbjct: 146 GMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRP 205 Query: 454 GSIAP 468 + P Sbjct: 206 SYVVP 210 >AB023220-1|BAA76847.2| 917|Homo sapiens KIAA1003 protein protein. Length = 917 Score = 37.9 bits (84), Expect = 0.034 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 G+ N GN+CY N+ LQAL C P + LE + K+ L S KK+ Sbjct: 150 GMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRP 209 Query: 454 GSIAP 468 + P Sbjct: 210 SYVVP 214 >BC014176-1|AAH14176.1| 640|Homo sapiens ubiquitin specific peptidase 49 protein. Length = 640 Score = 37.5 bits (83), Expect = 0.044 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFRE 351 GL N GNTCY NS+LQ L + FRE Sbjct: 254 GLRNLGNTCYMNSILQVLSHLQKFRE 279 >AL365205-13|CAI13188.1| 640|Homo sapiens ubiquitin specific peptidase 49 protein. Length = 640 Score = 37.5 bits (83), Expect = 0.044 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFRE 351 GL N GNTCY NS+LQ L + FRE Sbjct: 254 GLRNLGNTCYMNSILQVLSHLQKFRE 279 >AL365205-12|CAI13186.1| 585|Homo sapiens ubiquitin specific peptidase 49 protein. Length = 585 Score = 37.5 bits (83), Expect = 0.044 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFRE 351 GL N GNTCY NS+LQ L + FRE Sbjct: 254 GLRNLGNTCYMNSILQVLSHLQKFRE 279 >AL365205-11|CAI13187.1| 688|Homo sapiens ubiquitin specific peptidase 49 protein. Length = 688 Score = 37.5 bits (83), Expect = 0.044 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFRE 351 GL N GNTCY NS+LQ L + FRE Sbjct: 254 GLRNLGNTCYMNSILQVLSHLQKFRE 279 >AJ586139-1|CAE51939.1| 688|Homo sapiens ubiquitin-specific proteinase 49 protein. Length = 688 Score = 37.5 bits (83), Expect = 0.044 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFRE 351 GL N GNTCY NS+LQ L + FRE Sbjct: 254 GLRNLGNTCYMNSILQVLSHLQKFRE 279 >BC075792-1|AAH75792.1| 1055|Homo sapiens ubiquitin specific peptidase 25 protein. Length = 1055 Score = 37.1 bits (82), Expect = 0.059 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC+ ++V+Q+L+ FR VL YK Sbjct: 170 GLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYK 201 >BC015930-1|AAH15930.1| 450|Homo sapiens USP25 protein protein. Length = 450 Score = 37.1 bits (82), Expect = 0.059 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC+ ++V+Q+L+ FR VL YK Sbjct: 170 GLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYK 201 >AF170562-1|AAF32263.1| 1087|Homo sapiens ubiquitin-specific processing protease protein. Length = 1087 Score = 37.1 bits (82), Expect = 0.059 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC+ ++V+Q+L+ FR VL YK Sbjct: 170 GLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYK 201 >AF134213-1|AAF24998.1| 1055|Homo sapiens ubiquitin-specific protease protein. Length = 1055 Score = 37.1 bits (82), Expect = 0.059 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC+ ++V+Q+L+ FR VL YK Sbjct: 170 GLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYK 201 >Y13619-1|CAA73941.1| 2070|Homo sapiens DFFRY protein. Length = 2070 Score = 36.7 bits (81), Expect = 0.077 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 256 PNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVL 360 P + + GL N G TCY NSV+Q LY R +L Sbjct: 1554 PPKGFVGLKNAGATCYMNSVIQQLYMIPSIRNSIL 1588 >Y13618-1|CAA73940.1| 2555|Homo sapiens DFFRY protein. Length = 2555 Score = 36.7 bits (81), Expect = 0.077 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 256 PNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVL 360 P + + GL N G TCY NSV+Q LY R +L Sbjct: 1554 PPKGFVGLKNAGATCYMNSVIQQLYMIPSIRNSIL 1588 >AF000986-1|AAC51833.1| 2555|Homo sapiens ubiquitin specific protease 9 protein. Length = 2555 Score = 36.7 bits (81), Expect = 0.077 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 256 PNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVL 360 P + + GL N G TCY NSV+Q LY R +L Sbjct: 1554 PPKGFVGLKNAGATCYMNSVIQQLYMIPSIRNSIL 1588 >BC146752-1|AAI46753.1| 1318|Homo sapiens ubiquitin specific peptidase 19 protein. Length = 1318 Score = 36.3 bits (80), Expect = 0.10 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFRE 351 + GLVN GNTC+ NSV+Q+L R R+ Sbjct: 496 FTGLVNLGNTCFMNSVIQSLSNTRELRD 523 >BC142727-1|AAI42728.1| 1449|Homo sapiens USP19 protein protein. Length = 1449 Score = 36.3 bits (80), Expect = 0.10 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFRE 351 + GLVN GNTC+ NSV+Q+L R R+ Sbjct: 664 FTGLVNLGNTCFMNSVIQSLSNTRELRD 691 >BC142660-1|AAI42661.1| 1447|Homo sapiens USP19 protein protein. Length = 1447 Score = 36.3 bits (80), Expect = 0.10 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFRE 351 + GLVN GNTC+ NSV+Q+L R R+ Sbjct: 662 FTGLVNLGNTCFMNSVIQSLSNTRELRD 689 >BC106029-1|AAI06030.1| 799|Homo sapiens USP19 protein protein. Length = 799 Score = 36.3 bits (80), Expect = 0.10 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFRE 351 + GLVN GNTC+ NSV+Q+L R R+ Sbjct: 642 FTGLVNLGNTCFMNSVIQSLSNTRELRD 669 >BC082241-1|AAH82241.1| 1179|Homo sapiens USP19 protein protein. Length = 1179 Score = 36.3 bits (80), Expect = 0.10 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFRE 351 + GLVN GNTC+ NSV+Q+L R R+ Sbjct: 394 FTGLVNLGNTCFMNSVIQSLSNTRELRD 421 >AB020698-1|BAA74914.1| 1371|Homo sapiens KIAA0891 protein protein. Length = 1371 Score = 36.3 bits (80), Expect = 0.10 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFRE 351 + GLVN GNTC+ NSV+Q+L R R+ Sbjct: 549 FTGLVNLGNTCFMNSVIQSLSNTRELRD 576 >X98296-1|CAA66942.1| 2547|Homo sapiens ubiquitin hydrolase protein. Length = 2547 Score = 35.9 bits (79), Expect = 0.14 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 256 PNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVL 360 P + + GL N G TCY NSV+Q LY R +L Sbjct: 1545 PPKGFVGLKNAGATCYMNSVIQQLYMIPSIRNGIL 1579 >BC090946-1|AAH90946.1| 565|Homo sapiens ubiquitin specific peptidase 21 protein. Length = 565 Score = 35.9 bits (79), Expect = 0.14 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFRE 351 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 211 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 238 >BC003130-1|AAH03130.2| 477|Homo sapiens USP21 protein protein. Length = 477 Score = 35.9 bits (79), Expect = 0.14 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFRE 351 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 123 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 150 >AL590714-3|CAH72142.1| 551|Homo sapiens ubiquitin specific peptidase 21 protein. Length = 551 Score = 35.9 bits (79), Expect = 0.14 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFRE 351 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 211 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 238 >AL590714-2|CAH72143.1| 565|Homo sapiens ubiquitin specific peptidase 21 protein. Length = 565 Score = 35.9 bits (79), Expect = 0.14 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFRE 351 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 211 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 238 >AL391259-2|CAD13527.2| 2547|Homo sapiens ubiquitin specific peptidase 9, X-linked protein. Length = 2547 Score = 35.9 bits (79), Expect = 0.14 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 256 PNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVL 360 P + + GL N G TCY NSV+Q LY R +L Sbjct: 1545 PPKGFVGLKNAGATCYMNSVIQQLYMIPSIRNGIL 1579 >AL157417-1|CAB75649.1| 268|Homo sapiens hypothetical protein protein. Length = 268 Score = 35.9 bits (79), Expect = 0.14 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFRE 351 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 21 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 48 >AL109797-1|CAD18900.2| 2547|Homo sapiens ubiquitin specific peptidase 9, X-linked protein. Length = 2547 Score = 35.9 bits (79), Expect = 0.14 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 256 PNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVL 360 P + + GL N G TCY NSV+Q LY R +L Sbjct: 1545 PPKGFVGLKNAGATCYMNSVIQQLYMIPSIRNGIL 1579 >AJ583823-1|CAE47750.2| 711|Homo sapiens ubiquitin specific proteinase 51 protein. Length = 711 Score = 35.9 bits (79), Expect = 0.14 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETL-LTC-LADLFYSI 432 GL+N GNTC+ N ++QAL ++ L K K T +L L C ++ LF+++ Sbjct: 364 GLINLGNTCFMNCIVQALTHIPLLKDFFLSDKHKCIMTSPSLCLVCEMSSLFHAM 418 >AF233442-1|AAF61308.1| 381|Homo sapiens NEDD8-specific protease protein. Length = 381 Score = 35.9 bits (79), Expect = 0.14 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFRE 351 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 27 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 54 >AF177758-1|AAD54321.1| 565|Homo sapiens ubiquitin specific protease 16 protein. Length = 565 Score = 35.9 bits (79), Expect = 0.14 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFRE 351 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 211 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 238 >AB208899-1|BAD92136.1| 410|Homo sapiens ubiquitin-specific protease 21 isoform b variant protein. Length = 410 Score = 35.9 bits (79), Expect = 0.14 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFRE 351 + GL N GNTC+ N+VLQ L RP R+ Sbjct: 239 HVGLRNLGNTCFLNAVLQCLSSTRPLRD 266 >X91349-1|CAA62690.1| 858|Homo sapiens de-ubiquitinase protein. Length = 858 Score = 35.5 bits (78), Expect = 0.18 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLE 363 Y G+ N GN+CY NSV+Q L+ F+ K ++ Sbjct: 325 YTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVD 356 >U47927-1|AAC50465.1| 858|Homo sapiens isopeptidase T protein. Length = 858 Score = 35.5 bits (78), Expect = 0.18 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLE 363 Y G+ N GN+CY NSV+Q L+ F+ K ++ Sbjct: 325 YTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVD 356 >U47924-8|AAB51314.1| 835|Homo sapiens isopeptidase T protein. Length = 835 Score = 35.5 bits (78), Expect = 0.18 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLE 363 Y G+ N GN+CY NSV+Q L+ F+ K ++ Sbjct: 325 YTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVD 356 >U47924-7|AAB51315.1| 858|Homo sapiens isopeptidase T protein. Length = 858 Score = 35.5 bits (78), Expect = 0.18 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLE 363 Y G+ N GN+CY NSV+Q L+ F+ K ++ Sbjct: 325 YTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVD 356 >U35116-1|AAA78934.1| 835|Homo sapiens ubiquitin isopeptidase T protein. Length = 835 Score = 35.5 bits (78), Expect = 0.18 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLE 363 Y G+ N GN+CY NSV+Q L+ F+ K ++ Sbjct: 325 YTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVD 356 >BC005139-1|AAH05139.1| 858|Homo sapiens USP5 protein protein. Length = 858 Score = 35.5 bits (78), Expect = 0.18 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLE 363 Y G+ N GN+CY NSV+Q L+ F+ K ++ Sbjct: 325 YTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVD 356 >BC004889-1|AAH04889.1| 835|Homo sapiens ubiquitin specific peptidase 5 (isopeptidase T) protein. Length = 835 Score = 35.5 bits (78), Expect = 0.18 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLE 363 Y G+ N GN+CY NSV+Q L+ F+ K ++ Sbjct: 325 YTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVD 356 >AL831918-1|CAD38579.1| 810|Homo sapiens hypothetical protein protein. Length = 810 Score = 35.5 bits (78), Expect = 0.18 Identities = 23/81 (28%), Positives = 34/81 (41%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKK 447 + GL N G TCY S +Q LY R+ V K +T L L +F + + Sbjct: 171 FVGLTNLGATCYLASTIQQLYMIPEARQAVFTAKYSEDMKHKTTLLELQKMFTYLMESEC 230 Query: 448 KVGSIAPKKFIARLRKEKEEL 510 K + P+ F +K+ L Sbjct: 231 K--AYNPRPFCKTYTMDKQPL 249 >AJ586138-1|CAE51938.1| 3395|Homo sapiens ubiquitin-specific proteinase 34 protein. Length = 3395 Score = 35.5 bits (78), Expect = 0.18 Identities = 23/81 (28%), Positives = 34/81 (41%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKK 447 + GL N G TCY S +Q LY R+ V K +T L L +F + + Sbjct: 1742 FVGLTNLGATCYLASTIQQLYMIPEARQAVFTAKYSEDMKHKTTLLELQKMFTYLMESEC 1801 Query: 448 KVGSIAPKKFIARLRKEKEEL 510 K + P+ F +K+ L Sbjct: 1802 K--AYNPRPFCKTYTMDKQPL 1820 >AB011142-1|BAA25496.2| 3412|Homo sapiens KIAA0570 protein protein. Length = 3412 Score = 35.5 bits (78), Expect = 0.18 Identities = 23/81 (28%), Positives = 34/81 (41%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKK 447 + GL N G TCY S +Q LY R+ V K +T L L +F + + Sbjct: 1759 FVGLTNLGATCYLASTIQQLYMIPEARQAVFTAKYSEDMKHKTTLLELQKMFTYLMESEC 1818 Query: 448 KVGSIAPKKFIARLRKEKEEL 510 K + P+ F +K+ L Sbjct: 1819 K--AYNPRPFCKTYTMDKQPL 1837 >BC133009-1|AAI33010.1| 979|Homo sapiens ubiquitin specific peptidase 37 protein. Length = 979 Score = 35.1 bits (77), Expect = 0.24 Identities = 25/85 (29%), Positives = 42/85 (49%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 G N GNTCY N++LQ+L+ + F +L+ + K+ L L F + KK + Sbjct: 342 GFSNLGNTCYMNAILQSLFSLQSFANDLLK---QGIPWKKIPLNALIRRFAHLLV-KKDI 397 Query: 454 GSIAPKKFIARLRKEKEELTITCNK 528 + KK + L+K K ++ T + Sbjct: 398 CNSETKKDL--LKKVKNAISATAER 420 >BC133007-1|AAI33008.1| 979|Homo sapiens USP37 protein protein. Length = 979 Score = 35.1 bits (77), Expect = 0.24 Identities = 25/85 (29%), Positives = 42/85 (49%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 G N GNTCY N++LQ+L+ + F +L+ + K+ L L F + KK + Sbjct: 342 GFSNLGNTCYMNAILQSLFSLQSFANDLLK---QGIPWKKIPLNALIRRFAHLLV-KKDI 397 Query: 454 GSIAPKKFIARLRKEKEELTITCNK 528 + KK + L+K K ++ T + Sbjct: 398 CNSETKKDL--LKKVKNAISATAER 420 >BC112901-1|AAI12902.1| 885|Homo sapiens USP37 protein protein. Length = 885 Score = 35.1 bits (77), Expect = 0.24 Identities = 25/85 (29%), Positives = 42/85 (49%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 G N GNTCY N++LQ+L+ + F +L+ + K+ L L F + KK + Sbjct: 270 GFSNLGNTCYMNAILQSLFSLQSFANDLLK---QGIPWKKIPLNALIRRFAHLLV-KKDI 325 Query: 454 GSIAPKKFIARLRKEKEELTITCNK 528 + KK + L+K K ++ T + Sbjct: 326 CNSETKKDL--LKKVKNAISATAER 348 >BC030704-1|AAH30704.1| 712|Homo sapiens ubiquitin specific peptidase 44 protein. Length = 712 Score = 35.1 bits (77), Expect = 0.24 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 363 GL N GNTCY NSVLQ L FR+ L+ Sbjct: 274 GLRNLGNTCYMNSVLQVLSHLLIFRQCFLK 303 >AL832645-1|CAD89955.1| 979|Homo sapiens hypothetical protein protein. Length = 979 Score = 35.1 bits (77), Expect = 0.24 Identities = 25/85 (29%), Positives = 42/85 (49%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 G N GNTCY N++LQ+L+ + F +L+ + K+ L L F + KK + Sbjct: 342 GFSNLGNTCYMNAILQSLFSLQSFANDLLK---QGIPWKKIPLNALIRRFAHLLV-KKDI 397 Query: 454 GSIAPKKFIARLRKEKEELTITCNK 528 + KK + L+K K ++ T + Sbjct: 398 CNSETKKDL--LKKVKNAISATAER 420 >AB046814-1|BAB13420.1| 931|Homo sapiens KIAA1594 protein protein. Length = 931 Score = 35.1 bits (77), Expect = 0.24 Identities = 25/85 (29%), Positives = 42/85 (49%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 G N GNTCY N++LQ+L+ + F +L+ + K+ L L F + KK + Sbjct: 294 GFSNLGNTCYMNAILQSLFSLQSFANDLLK---QGIPWKKIPLNALIRRFAHLLV-KKDI 349 Query: 454 GSIAPKKFIARLRKEKEELTITCNK 528 + KK + L+K K ++ T + Sbjct: 350 CNSETKKDL--LKKVKNAISATAER 372 >U20657-1|AAB72237.1| 963|Homo sapiens ubiquitin protease protein. Length = 963 Score = 34.7 bits (76), Expect = 0.31 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 6/50 (12%) Frame = +1 Query: 253 PPNEHY----FGLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKR 384 PP+ H GL N GNTC+ NS LQ L P + L EY+A+ R Sbjct: 292 PPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINR 341 >BC125131-1|AAI25132.1| 963|Homo sapiens ubiquitin specific peptidase 4 (proto-oncogene) protein. Length = 963 Score = 34.7 bits (76), Expect = 0.31 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 6/50 (12%) Frame = +1 Query: 253 PPNEHY----FGLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKR 384 PP+ H GL N GNTC+ NS LQ L P + L EY+A+ R Sbjct: 292 PPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINR 341 >BC125130-1|AAI25131.1| 963|Homo sapiens ubiquitin specific peptidase 4 (proto-oncogene) protein. Length = 963 Score = 34.7 bits (76), Expect = 0.31 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 6/50 (12%) Frame = +1 Query: 253 PPNEHY----FGLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKR 384 PP+ H GL N GNTC+ NS LQ L P + L EY+A+ R Sbjct: 292 PPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINR 341 >AK223292-1|BAD97012.1| 963|Homo sapiens ubiquitin specific protease, proto-oncogene isoform a variant protein. Length = 963 Score = 34.7 bits (76), Expect = 0.31 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 6/50 (12%) Frame = +1 Query: 253 PPNEHY----FGLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKR 384 PP+ H GL N GNTC+ NS LQ L P + L EY+A+ R Sbjct: 292 PPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINR 341 >AK222725-1|BAD96445.1| 916|Homo sapiens ubiquitin specific protease, proto-oncogene isoform b variant protein. Length = 916 Score = 34.7 bits (76), Expect = 0.31 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 6/50 (12%) Frame = +1 Query: 253 PPNEHY----FGLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKR 384 PP+ H GL N GNTC+ NS LQ L P + L EY+A+ R Sbjct: 245 PPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINR 294 >AF017306-1|AAC27356.1| 916|Homo sapiens UnpES protein. Length = 916 Score = 34.7 bits (76), Expect = 0.31 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 6/50 (12%) Frame = +1 Query: 253 PPNEHY----FGLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKR 384 PP+ H GL N GNTC+ NS LQ L P + L EY+A+ R Sbjct: 245 PPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINR 294 >AF017305-1|AAC27355.1| 963|Homo sapiens UnpEL protein. Length = 963 Score = 34.7 bits (76), Expect = 0.31 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 6/50 (12%) Frame = +1 Query: 253 PPNEHY----FGLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKR 384 PP+ H GL N GNTC+ NS LQ L P + L EY+A+ R Sbjct: 292 PPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINR 341 >D80012-1|BAA11507.1| 813|Homo sapiens KIAA0190 protein. Length = 813 Score = 34.3 bits (75), Expect = 0.41 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRP 342 GL+N GN CY N+ LQAL C P Sbjct: 431 GLINKGNWCYINATLQALVACPP 453 >BX537402-1|CAD97644.1| 824|Homo sapiens hypothetical protein protein. Length = 824 Score = 34.3 bits (75), Expect = 0.41 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRP 342 GL+N GN CY N+ LQAL C P Sbjct: 442 GLINKGNWCYINATLQALVACPP 464 >BC130398-1|AAI30399.1| 912|Homo sapiens USP29 protein protein. Length = 912 Score = 34.3 bits (75), Expect = 0.41 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVL 360 G N GNTCY N+VLQ+L+ F + +L Sbjct: 286 GFPNLGNTCYMNAVLQSLFAIPSFADDLL 314 >BC130394-1|AAI30395.1| 912|Homo sapiens USP29 protein protein. Length = 912 Score = 34.3 bits (75), Expect = 0.41 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVL 360 G N GNTCY N+VLQ+L+ F + +L Sbjct: 286 GFPNLGNTCYMNAVLQSLFAIPSFADDLL 314 >BC041366-1|AAH41366.1| 362|Homo sapiens USP2 protein protein. Length = 362 Score = 34.3 bits (75), Expect = 0.41 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 363 GL N GNTC+ NS+LQ L R R+ L+ Sbjct: 25 GLRNLGNTCFMNSILQCLSNTRELRDYCLQ 54 >BC002955-1|AAH02955.1| 605|Homo sapiens ubiquitin specific peptidase 2 protein. Length = 605 Score = 34.3 bits (75), Expect = 0.41 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 363 GL N GNTC+ NS+LQ L R R+ L+ Sbjct: 268 GLRNLGNTCFMNSILQCLSNTRELRDYCLQ 297 >BC002854-1|AAH02854.1| 605|Homo sapiens ubiquitin specific peptidase 2 protein. Length = 605 Score = 34.3 bits (75), Expect = 0.41 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 363 GL N GNTC+ NS+LQ L R R+ L+ Sbjct: 268 GLRNLGNTCFMNSILQCLSNTRELRDYCLQ 297 >BC000263-1|AAH00263.1| 798|Homo sapiens ubiquitin specific peptidase 10 protein. Length = 798 Score = 34.3 bits (75), Expect = 0.41 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRP 342 GL+N GN CY N+ LQAL C P Sbjct: 416 GLINKGNWCYINATLQALVACPP 438 >AK057225-1|BAB71388.1| 605|Homo sapiens protein ( Homo sapiens cDNA FLJ32663 fis, clone TESTI1000070, highly similar to Rattus norvegicus deubiquitinating enzyme Ubp69 (ubp69) mRNA. ). Length = 605 Score = 34.3 bits (75), Expect = 0.41 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 363 GL N GNTC+ NS+LQ L R R+ L+ Sbjct: 268 GLRNLGNTCFMNSILQCLSNTRELRDYCLQ 297 >AF440755-1|AAN65363.1| 396|Homo sapiens ubiquitin specific protease 2b protein. Length = 396 Score = 34.3 bits (75), Expect = 0.41 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 363 GL N GNTC+ NS+LQ L R R+ L+ Sbjct: 59 GLRNLGNTCFMNSILQCLSNTRELRDYCLQ 88 >AF229438-1|AAG10401.1| 922|Homo sapiens ubiquitin-specific processing protease protein. Length = 922 Score = 34.3 bits (75), Expect = 0.41 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVL 360 G N GNTCY N+VLQ+L+ F + +L Sbjct: 286 GFPNLGNTCYMNAVLQSLFAIPSFADDLL 314 >AF079564-1|AAC28392.1| 353|Homo sapiens ubiquitin-specific protease UBP41 protein. Length = 353 Score = 34.3 bits (75), Expect = 0.41 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLE 363 GL N GNTC+ NS+LQ L R R+ L+ Sbjct: 16 GLRNLGNTCFMNSILQCLSNTRELRDYCLQ 45 >BC132862-1|AAI32863.1| 1316|Homo sapiens ubiquitin specific peptidase 42 protein. Length = 1316 Score = 33.9 bits (74), Expect = 0.55 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC++N+ LQ L + P +L ++ Sbjct: 112 GLQNLGNTCFANAALQCLTYTPPLANYMLSHE 143 >BC060846-1|AAH60846.2| 1202|Homo sapiens USP42 protein protein. Length = 1202 Score = 33.9 bits (74), Expect = 0.55 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC++N+ LQ L + P +L ++ Sbjct: 112 GLQNLGNTCFANAALQCLTYTPPLANYMLSHE 143 >AY618868-1|AAT67238.1| 1324|Homo sapiens ubiquitin specific protease 42 protein. Length = 1324 Score = 33.9 bits (74), Expect = 0.55 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC++N+ LQ L + P +L ++ Sbjct: 112 GLQNLGNTCFANAALQCLTYTPPLANYMLSHE 143 >AK022759-1|BAB14232.1| 1198|Homo sapiens protein ( Homo sapiens cDNA FLJ12697 fis, clone NT2RP1000522, weakly similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE DUB-1 (EC 3.1.2.15). ). Length = 1198 Score = 33.9 bits (74), Expect = 0.55 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC++N+ LQ L + P +L ++ Sbjct: 112 GLQNLGNTCFANAALQCLTYTPPLANYMLSHE 143 >AJ601395-1|CAE53097.1| 1325|Homo sapiens ubiquitin-specific protease 42 protein. Length = 1325 Score = 33.9 bits (74), Expect = 0.55 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC++N+ LQ L + P +L ++ Sbjct: 112 GLQNLGNTCFANAALQCLTYTPPLANYMLSHE 143 >U75362-1|AAC63405.1| 863|Homo sapiens isopeptidase T-3 protein. Length = 863 Score = 33.1 bits (72), Expect = 0.95 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFR 348 Y GL N GN+CY +SV+QA++ F+ Sbjct: 335 YTGLKNLGNSCYLSSVMQAIFSIPEFQ 361 >BC125123-1|AAI25124.1| 952|Homo sapiens ubiquitin specific peptidase 15 protein. Length = 952 Score = 33.1 bits (72), Expect = 0.95 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 GL N GNTC+ NS +Q L P E L K + + + L ++ S A K++ Sbjct: 261 GLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQM 320 Query: 454 GS 459 S Sbjct: 321 WS 322 >BC016146-1|AAH16146.1| 863|Homo sapiens ubiquitin specific peptidase 13 (isopeptidase T-3) protein. Length = 863 Score = 33.1 bits (72), Expect = 0.95 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFR 348 Y GL N GN+CY +SV+QA++ F+ Sbjct: 335 YTGLKNLGNSCYLSSVMQAIFSIPEFQ 361 >AY509884-1|AAR91701.1| 530|Homo sapiens deubiquitinating enzyme 3 protein. Length = 530 Score = 33.1 bits (72), Expect = 0.95 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVL 360 GL N GNTCY N+ LQ L + P +L Sbjct: 81 GLQNMGNTCYENASLQCLTYTPPLANYML 109 >AF153604-1|AAD41086.1| 981|Homo sapiens ubiquitin-specific protease homolog protein. Length = 981 Score = 33.1 bits (72), Expect = 0.95 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 GL N GNTC+ NS +Q L P E L K + + + L ++ S A K++ Sbjct: 290 GLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQM 349 Query: 454 GS 459 S Sbjct: 350 WS 351 >AF106069-1|AAD52099.1| 952|Homo sapiens deubiquitinating enzyme protein. Length = 952 Score = 33.1 bits (72), Expect = 0.95 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 GL N GNTC+ NS +Q L P E L K + + + L ++ S A K++ Sbjct: 261 GLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQM 320 Query: 454 GS 459 S Sbjct: 321 WS 322 >AF013990-1|AAG28973.1| 902|Homo sapiens ubiquitin C-terminal hydrolase protein. Length = 902 Score = 33.1 bits (72), Expect = 0.95 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 GL N GNTC+ NS +Q L P E L K + + + L ++ S A K++ Sbjct: 211 GLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQM 270 Query: 454 GS 459 S Sbjct: 271 WS 272 >AB011101-1|BAA25455.2| 952|Homo sapiens KIAA0529 protein protein. Length = 952 Score = 33.1 bits (72), Expect = 0.95 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 GL N GNTC+ NS +Q L P E L K + + + L ++ S A K++ Sbjct: 261 GLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQM 320 Query: 454 GS 459 S Sbjct: 321 WS 322 >D29956-1|BAA06225.2| 1120|Homo sapiens KIAA0055 protein. Length = 1120 Score = 32.7 bits (71), Expect = 1.3 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL 327 GL N GNTCY NS+LQ L Sbjct: 780 GLRNLGNTCYMNSILQCL 797 >BX538024-1|CAD97970.1| 979|Homo sapiens hypothetical protein protein. Length = 979 Score = 32.7 bits (71), Expect = 1.3 Identities = 24/85 (28%), Positives = 41/85 (48%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKKKV 453 G GNTCY N++LQ+L+ + F +L+ + K+ L L F + KK + Sbjct: 342 GFSKLGNTCYMNAILQSLFSLQSFANDLLK---QGIPWKKIPLNALIRRFAHLLV-KKDI 397 Query: 454 GSIAPKKFIARLRKEKEELTITCNK 528 + KK + L+K K ++ T + Sbjct: 398 CNSETKKDL--LKKVKNAISATAER 420 >BX537420-1|CAD97662.1| 1118|Homo sapiens hypothetical protein protein. Length = 1118 Score = 32.7 bits (71), Expect = 1.3 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL 327 GL N GNTCY NS+LQ L Sbjct: 778 GLRNLGNTCYMNSILQCL 795 >BC110590-1|AAI10591.1| 1118|Homo sapiens ubiquitin specific peptidase 8 protein. Length = 1118 Score = 32.7 bits (71), Expect = 1.3 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL 327 GL N GNTCY NS+LQ L Sbjct: 778 GLRNLGNTCYMNSILQCL 795 >U30888-1|AAB60365.1| 494|Homo sapiens tRNA-Guanine Transglycosylase protein. Length = 494 Score = 32.3 bits (70), Expect = 1.7 Identities = 20/74 (27%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEY----KAKNKRTKETLLT-CLADLFYSIAT 438 GL N GNTCY N+ +Q + ++ + Y +A + +T L DLF S+ Sbjct: 106 GLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDK 165 Query: 439 QKKKVGSIAPKKFI 480 + I +F+ Sbjct: 166 TSSSIPPIILLQFL 179 >BX640815-1|CAE45893.1| 453|Homo sapiens hypothetical protein protein. Length = 453 Score = 32.3 bits (70), Expect = 1.7 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTC-LADLF 423 GL+N GNTC+ N ++QAL R+ L + + ++ + L C ++ LF Sbjct: 105 GLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLF 156 >BT007183-1|AAP35847.1| 494|Homo sapiens ubiquitin specific protease 14 (tRNA-guanine transglycosylase) protein. Length = 494 Score = 32.3 bits (70), Expect = 1.7 Identities = 20/74 (27%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEY----KAKNKRTKETLLT-CLADLFYSIAT 438 GL N GNTCY N+ +Q + ++ + Y +A + +T L DLF S+ Sbjct: 106 GLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDK 165 Query: 439 QKKKVGSIAPKKFI 480 + I +F+ Sbjct: 166 TSSSIPPIILLQFL 179 >BC126898-1|AAI26899.1| 513|Homo sapiens USP22 protein protein. Length = 513 Score = 32.3 bits (70), Expect = 1.7 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTC-LADLF 423 GL+N GNTC+ N ++QAL R+ L + + ++ + L C ++ LF Sbjct: 165 GLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLF 216 >BC110499-1|AAI10500.1| 512|Homo sapiens USP22 protein protein. Length = 512 Score = 32.3 bits (70), Expect = 1.7 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTC-LADLF 423 GL+N GNTC+ N ++QAL R+ L + + ++ + L C ++ LF Sbjct: 164 GLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLF 215 >BC003556-1|AAH03556.1| 494|Homo sapiens ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) protein. Length = 494 Score = 32.3 bits (70), Expect = 1.7 Identities = 20/74 (27%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEY----KAKNKRTKETLLT-CLADLFYSIAT 438 GL N GNTCY N+ +Q + ++ + Y +A + +T L DLF S+ Sbjct: 106 GLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDK 165 Query: 439 QKKKVGSIAPKKFI 480 + I +F+ Sbjct: 166 TSSSIPPIILLQFL 179 >AY533200-1|AAS59847.1| 398|Homo sapiens deubiquitinating enzyme DUB4 protein. Length = 398 Score = 32.3 bits (70), Expect = 1.7 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVL 360 GL N GNTCY N+ LQ L + P +L Sbjct: 81 GLQNMGNTCYVNASLQCLTYTPPLANYML 109 >AY188990-1|AAO38845.1| 530|Homo sapiens deubiquitinating enzyme 3 protein. Length = 530 Score = 32.3 bits (70), Expect = 1.7 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVL 360 GL N GNTCY N+ LQ L + P +L Sbjct: 81 GLQNMGNTCYVNASLQCLTYTPPLANYML 109 >AK098514-1|BAC05320.1| 157|Homo sapiens protein ( Homo sapiens cDNA FLJ25648 fis, clone SYN01015. ). Length = 157 Score = 32.3 bits (70), Expect = 1.7 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -1 Query: 558 LLGSSGIHGHLVACNCQFLLFLPKSSNKFFRCN*SNF-FLLS 436 L + +GHLV+C+C + FLP + K+ + S FLLS Sbjct: 20 LASAHNFYGHLVSCHCSLIYFLPLPTTKWNHISKSLIAFLLS 61 >AF544012-1|AAQ11742.1| 530|Homo sapiens deubiquitinating enzyme DUB2 protein. Length = 530 Score = 32.3 bits (70), Expect = 1.7 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVL 360 GL N GNTCY N+ LQ L + P +L Sbjct: 81 GLQNMGNTCYVNASLQCLTYTPPLANYML 109 >AF544011-1|AAQ11741.1| 530|Homo sapiens deubiquitinating enzyme DUB1 protein. Length = 530 Score = 32.3 bits (70), Expect = 1.7 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVL 360 GL N GNTCY N+ LQ L + P +L Sbjct: 81 GLQNMGNTCYVNASLQCLTYTPPLANYML 109 >AB028986-1|BAA83015.1| 593|Homo sapiens KIAA1063 protein protein. Length = 593 Score = 32.3 bits (70), Expect = 1.7 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAK-NKRTKETLLTC-LADLF 423 GL+N GNTC+ N ++QAL R+ L + + ++ + L C ++ LF Sbjct: 245 GLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLF 296 >BT007269-1|AAP35933.1| 520|Homo sapiens ubiquitin specific protease 3 protein. Length = 520 Score = 31.9 bits (69), Expect = 2.2 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL----YFCRPFRE 351 GL N GNTC+ N++LQ+L FC F+E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 189 Score = 31.9 bits (69), Expect = 2.2 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 Query: 516 YMQQDAHEFLNFLINHIN 569 Y QQDAHEF+ +L++H++ Sbjct: 256 YQQQDAHEFMRYLLDHLH 273 >BC107138-1|AAI07139.1| 520|Homo sapiens ubiquitin specific peptidase 3 protein. Length = 520 Score = 31.9 bits (69), Expect = 2.2 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL----YFCRPFRE 351 GL N GNTC+ N++LQ+L FC F+E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 189 Score = 31.9 bits (69), Expect = 2.2 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 Query: 516 YMQQDAHEFLNFLINHIN 569 Y QQDAHEF+ +L++H++ Sbjct: 256 YQQQDAHEFMRYLLDHLH 273 >BC107137-1|AAI07138.1| 520|Homo sapiens ubiquitin specific peptidase 3 protein. Length = 520 Score = 31.9 bits (69), Expect = 2.2 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL----YFCRPFRE 351 GL N GNTC+ N++LQ+L FC F+E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 189 Score = 31.9 bits (69), Expect = 2.2 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 Query: 516 YMQQDAHEFLNFLINHIN 569 Y QQDAHEF+ +L++H++ Sbjct: 256 YQQQDAHEFMRYLLDHLH 273 >BC100029-1|AAI00030.1| 393|Homo sapiens USP3 protein protein. Length = 393 Score = 31.9 bits (69), Expect = 2.2 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL----YFCRPFRE 351 GL N GNTC+ N++LQ+L FC F+E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 189 Score = 31.9 bits (69), Expect = 2.2 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 Query: 516 YMQQDAHEFLNFLINHIN 569 Y QQDAHEF+ +L++H++ Sbjct: 256 YQQQDAHEFMRYLLDHLH 273 >BC071582-1|AAH71582.1| 1123|Homo sapiens USP36 protein protein. Length = 1123 Score = 31.9 bits (69), Expect = 2.2 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 450 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 123 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 181 Query: 451 VGSIAPKKFIARLRK 495 +I P FI L+K Sbjct: 182 GNAIKPVSFIRDLKK 196 >BC065300-1|AAH65300.1| 520|Homo sapiens ubiquitin specific peptidase 3 protein. Length = 520 Score = 31.9 bits (69), Expect = 2.2 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL----YFCRPFRE 351 GL N GNTC+ N++LQ+L FC F+E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 189 Score = 31.9 bits (69), Expect = 2.2 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 Query: 516 YMQQDAHEFLNFLINHIN 569 Y QQDAHEF+ +L++H++ Sbjct: 256 YQQQDAHEFMRYLLDHLH 273 >BC038983-1|AAH38983.1| 285|Homo sapiens USP36 protein protein. Length = 285 Score = 31.9 bits (69), Expect = 2.2 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 450 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 123 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 181 Query: 451 VGSIAPKKFIARLRK 495 +I P FI L+K Sbjct: 182 GNAIKPVSFIRDLKK 196 >BC027992-1|AAH27992.1| 959|Homo sapiens USP36 protein protein. Length = 959 Score = 31.9 bits (69), Expect = 2.2 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 450 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 123 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 181 Query: 451 VGSIAPKKFIARLRK 495 +I P FI L+K Sbjct: 182 GNAIKPVSFIRDLKK 196 >BC018113-1|AAH18113.1| 520|Homo sapiens ubiquitin specific peptidase 3 protein. Length = 520 Score = 31.9 bits (69), Expect = 2.2 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL----YFCRPFRE 351 GL N GNTC+ N++LQ+L FC F+E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 189 Score = 31.9 bits (69), Expect = 2.2 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 Query: 516 YMQQDAHEFLNFLINHIN 569 Y QQDAHEF+ +L++H++ Sbjct: 256 YQQQDAHEFMRYLLDHLH 273 >BC016487-1|AAH16487.1| 963|Homo sapiens Unknown (protein for IMAGE:3924730) protein. Length = 963 Score = 31.9 bits (69), Expect = 2.2 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 450 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 123 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 181 Query: 451 VGSIAPKKFIARLRK 495 +I P FI L+K Sbjct: 182 GNAIKPVSFIRDLKK 196 >AY461579-1|AAT37507.1| 498|Homo sapiens UBP protein protein. Length = 498 Score = 31.9 bits (69), Expect = 2.2 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL----YFCRPFRE 351 GL N GNTC+ N++LQ+L FC F+E Sbjct: 138 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 167 Score = 31.9 bits (69), Expect = 2.2 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 Query: 516 YMQQDAHEFLNFLINHIN 569 Y QQDAHEF+ +L++H++ Sbjct: 234 YQQQDAHEFMRYLLDHLH 251 >AY169386-1|AAO34133.1| 548|Homo sapiens deubiquitinating enzyme 1 protein. Length = 548 Score = 31.9 bits (69), Expect = 2.2 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 450 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 123 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 181 Query: 451 VGSIAPKKFIARLRK 495 +I P FI L+K Sbjct: 182 GNAIKPVSFIRDLKK 196 >AK022913-1|BAB14306.1| 548|Homo sapiens protein ( Homo sapiens cDNA FLJ12851 fis, clone NT2RP2003401, weakly similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE DUB-1 (EC 3.1.2.15). ). Length = 548 Score = 31.9 bits (69), Expect = 2.2 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 450 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 123 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 181 Query: 451 VGSIAPKKFIARLRK 495 +I P FI L+K Sbjct: 182 GNAIKPVSFIRDLKK 196 >AK001671-1|BAA91825.1| 954|Homo sapiens protein ( Homo sapiens cDNA FLJ10809 fis, clone NT2RP4000927, weakly similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE DUB-1 (EC 3.1.2.15). ). Length = 954 Score = 31.9 bits (69), Expect = 2.2 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 450 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 123 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 181 Query: 451 VGSIAPKKFIARLRK 495 +I P FI L+K Sbjct: 182 GNAIKPVSFIRDLKK 196 >AF073344-1|AAD42992.1| 521|Homo sapiens ubiquitin-specific protease 3 protein. Length = 521 Score = 31.9 bits (69), Expect = 2.2 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL----YFCRPFRE 351 GL N GNTC+ N++LQ+L FC F+E Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKE 189 >AB040886-1|BAA95977.1| 1123|Homo sapiens KIAA1453 protein protein. Length = 1123 Score = 31.9 bits (69), Expect = 2.2 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK-AKNKRTKETLLTCLADLFYSIATQKKK 450 GL N GNTC+ N+ +Q L + P +L + A++ + C+ + + Sbjct: 125 GLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQ-NHIVQAFANS 183 Query: 451 VGSIAPKKFIARLRK 495 +I P FI L+K Sbjct: 184 GNAIKPVSFIRDLKK 198 >X63547-2|CAA45111.1| 1089|Homo sapiens oncogene protein. Length = 1089 Score = 31.5 bits (68), Expect = 2.9 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 7/89 (7%) Frame = +1 Query: 250 VPPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKRT-----KETLLTC 408 VP + GL N GNTC+ NS +Q + +P + + + + RT K + C Sbjct: 208 VPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKC 267 Query: 409 LADLFYSIATQKKKVGSIAPKKFIARLRK 495 DL + + +K S+AP K + K Sbjct: 268 YGDLVQELWSGTQK--SVAPLKLRRTIAK 294 >X63546-1|CAA45108.1| 786|Homo sapiens oncogene protein. Length = 786 Score = 31.5 bits (68), Expect = 2.9 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 7/89 (7%) Frame = +1 Query: 250 VPPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKRT-----KETLLTC 408 VP + GL N GNTC+ NS +Q + +P + + + + RT K + C Sbjct: 525 VPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKC 584 Query: 409 LADLFYSIATQKKKVGSIAPKKFIARLRK 495 DL + + +K S+AP K + K Sbjct: 585 YGDLVQELWSGTQK--SVAPLKLRRTIAK 611 >AY143550-1|AAN38838.1| 1406|Homo sapiens ubiquitin-specific protease USP6 protein. Length = 1406 Score = 31.5 bits (68), Expect = 2.9 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 7/89 (7%) Frame = +1 Query: 250 VPPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVL--EYKAKNKRT-----KETLLTC 408 VP + GL N GNTC+ NS +Q + +P + + + + RT K + C Sbjct: 525 VPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKC 584 Query: 409 LADLFYSIATQKKKVGSIAPKKFIARLRK 495 DL + + +K S+AP K + K Sbjct: 585 YGDLVQELWSGTQK--SVAPLKLRRTIAK 611 >U44839-1|AAC50450.1| 690|Homo sapiens UHX1 protein protein. Length = 690 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL 327 GL N GNTC+ NS LQ L Sbjct: 37 GLTNLGNTCFMNSALQCL 54 >BC063668-1|AAH63668.1| 923|Homo sapiens USP11 protein protein. Length = 923 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL 327 GL N GNTC+ NS LQ L Sbjct: 270 GLTNLGNTCFMNSALQCL 287 >BC030777-1|AAH30777.1| 822|Homo sapiens ubiquitin specific peptidase 16 protein. Length = 822 Score = 31.1 bits (67), Expect = 3.8 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC+ N+V+Q L RE + E K Sbjct: 196 GLSNLGNTCFFNAVMQNLSQTPVLRELLKEVK 227 >BC000350-1|AAH00350.4| 921|Homo sapiens USP11 protein protein. Length = 921 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL 327 GL N GNTC+ NS LQ L Sbjct: 268 GLTNLGNTCFMNSALQCL 285 >AY333928-1|AAR13293.1| 408|Homo sapiens USP16 protein. Length = 408 Score = 31.1 bits (67), Expect = 3.8 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC+ N+V+Q L RE + E K Sbjct: 197 GLSNLGNTCFFNAVMQNLSQTPVLRELLKEVK 228 >AL163249-3|CAB90432.1| 823|Homo sapiens human ubiquitin processing protease, EC 3.1.2.15 protein. Length = 823 Score = 31.1 bits (67), Expect = 3.8 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC+ N+V+Q L RE + E K Sbjct: 197 GLSNLGNTCFFNAVMQNLSQTPVLRELLKEVK 228 >AL096791-3|CAD20056.1| 690|Homo sapiens ubiquitin specific peptidase 11 protein. Length = 690 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL 327 GL N GNTC+ NS LQ L Sbjct: 37 GLTNLGNTCFMNSALQCL 54 >AL096791-2|CAI42996.1| 140|Homo sapiens ubiquitin specific peptidase 11 protein. Length = 140 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL 327 GL N GNTC+ NS LQ L Sbjct: 37 GLTNLGNTCFMNSALQCL 54 >AK222884-1|BAD96604.1| 823|Homo sapiens ubiquitin specific protease 16 isoform a variant protein. Length = 823 Score = 31.1 bits (67), Expect = 3.8 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC+ N+V+Q L RE + E K Sbjct: 197 GLSNLGNTCFFNAVMQNLSQTPVLRELLKEVK 228 >AK222681-1|BAD96401.1| 823|Homo sapiens ubiquitin specific protease 16 isoform a variant protein. Length = 823 Score = 31.1 bits (67), Expect = 3.8 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC+ N+V+Q L RE + E K Sbjct: 197 GLSNLGNTCFFNAVMQNLSQTPVLRELLKEVK 228 >AK127075-1|BAC86814.1| 1332|Homo sapiens protein ( Homo sapiens cDNA FLJ45132 fis, clone BRAWH3037979, highly similar to Ubiquitin carboxyl-terminal hydrolase 24 (EC 3.1.2.15). ). Length = 1332 Score = 31.1 bits (67), Expect = 3.8 Identities = 21/83 (25%), Positives = 35/83 (42%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKK 447 + GL N G TCY N+V Q LY E +L +++ + LF + + Sbjct: 938 FVGLRNGGATCYMNAVFQQLYMQPGLPESLLSVDDDTDNPDDSVFYQVQSLFGHL--MES 995 Query: 448 KVGSIAPKKFIARLRKEKEELTI 516 K+ P+ F + +EL + Sbjct: 996 KLQYYVPENFWKIFKMWNKELYV 1018 >AF126736-1|AAD20949.1| 823|Homo sapiens ubiquitin processing protease protein. Length = 823 Score = 31.1 bits (67), Expect = 3.8 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQALYFCRPFREKVLEYK 369 GL N GNTC+ N+V+Q L RE + E K Sbjct: 197 GLSNLGNTCFFNAVMQNLSQTPVLRELLKEVK 228 >AB073597-1|BAC20463.1| 921|Homo sapiens deubiquitinating enzyme protein. Length = 921 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 274 GLVNFGNTCYSNSVLQAL 327 GL N GNTC+ NS LQ L Sbjct: 268 GLTNLGNTCFMNSALQCL 285 >AB028980-1|BAA83009.1| 977|Homo sapiens KIAA1057 protein protein. Length = 977 Score = 31.1 bits (67), Expect = 3.8 Identities = 21/83 (25%), Positives = 35/83 (42%) Frame = +1 Query: 268 YFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKAKNKRTKETLLTCLADLFYSIATQKK 447 + GL N G TCY N+V Q LY E +L +++ + LF + + Sbjct: 45 FVGLRNGGATCYMNAVFQQLYMQPGLPESLLSVDDDTDNPDDSVFYQVQSLFGHL--MES 102 Query: 448 KVGSIAPKKFIARLRKEKEELTI 516 K+ P+ F + +EL + Sbjct: 103 KLQYYVPENFWKIFKMWNKELYV 125 >AK127803-1|BAC87142.1| 1063|Homo sapiens protein ( Homo sapiens cDNA FLJ45904 fis, clone OCBBF3026361. ). Length = 1063 Score = 30.7 bits (66), Expect = 5.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 555 LGSSGIHGHLVACNCQFLLFLPKSSNKFFRC 463 LG+ G +GH Q + PK +NKFF+C Sbjct: 80 LGTGGYYGHSPGYYGQHIAANPKPTNKFFQC 110 >AF533230-1|AAM97922.1| 1604|Homo sapiens ubiquitin-specific protease USP32 protein. Length = 1604 Score = 30.7 bits (66), Expect = 5.1 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 250 VPPNEHYFGLVNFGNTCYSNSVLQALYFCRPFRE 351 VP + GL N GNTC+ NS +Q + +P + Sbjct: 727 VPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQ 760 >AF350251-1|AAK30207.1| 1274|Homo sapiens ubiquitin specific protease protein. Length = 1274 Score = 30.7 bits (66), Expect = 5.1 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 250 VPPNEHYFGLVNFGNTCYSNSVLQALYFCRPFRE 351 VP + GL N GNTC+ NS +Q + +P + Sbjct: 397 VPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQ 430 >AF155116-1|AAD42882.1| 828|Homo sapiens NY-REN-60 antigen protein. Length = 828 Score = 30.7 bits (66), Expect = 5.1 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 250 VPPNEHYFGLVNFGNTCYSNSVLQALYFCRPFRE 351 VP + GL N GNTC+ NS +Q + +P + Sbjct: 192 VPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQ 225 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,701,739 Number of Sequences: 237096 Number of extensions: 1771745 Number of successful extensions: 3576 Number of sequences better than 10.0: 172 Number of HSP's better than 10.0 without gapping: 3367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3569 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -