BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060327.seq (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.07c |atg13|apg13, mug78|autophagy associated protein At... 26 4.4 SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|... 26 4.4 SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizo... 25 7.8 SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe... 25 7.8 SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi... 25 7.8 >SPAC4F10.07c |atg13|apg13, mug78|autophagy associated protein Atg13 |Schizosaccharomyces pombe|chr 1|||Manual Length = 758 Score = 26.2 bits (55), Expect = 4.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 438 GPVSEPTKIVPEHQTEAAKKSETSRQL 518 G P+ ++P QTE ++TS+QL Sbjct: 605 GDNRSPSTVIPHTQTEVPSANDTSKQL 631 >SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|chr 2|||Manual Length = 446 Score = 26.2 bits (55), Expect = 4.4 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 183 MRNGYCSSQLGSRLFSRQCYAHG 115 ++ G C +Q+GS+ + + C HG Sbjct: 8 LQAGQCGNQIGSQFWQQLCLEHG 30 >SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 483 Score = 25.4 bits (53), Expect = 7.8 Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +2 Query: 131 CRLN-SLEPNWELQYPFLMISLKLQVNLKKTQQQF 232 CRLN S +PN ++ + ++ L + ++KK +Q F Sbjct: 190 CRLNHSCDPNCQIIFDGAIVQLVSKRDIKKDEQLF 224 >SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 426 Score = 25.4 bits (53), Expect = 7.8 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +2 Query: 44 CLFLLKISFISK*RSWRSSVY*NLPCA*HCRLNSLEPNWELQYPFLMISLK 196 C F L I ++ R+ S++ +LP LN L+ + +L P+ +S+K Sbjct: 81 CFFCLLIDYLGGERAAVISLHGHLPRPRLWPLNYLQDDIDLSDPYTFLSIK 131 >SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3071 Score = 25.4 bits (53), Expect = 7.8 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 641 WESFLDPWSLGL 676 WE FL+PW +G+ Sbjct: 1743 WEPFLEPWKVGV 1754 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,275,648 Number of Sequences: 5004 Number of extensions: 36631 Number of successful extensions: 99 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -