BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060327.seq (687 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0770 + 11038971-11039392,11040071-11040353,11040697-11040798 28 8.0 02_03_0305 + 17527906-17528148,17528986-17529051,17529624-17530808 28 8.0 01_06_0646 - 30832201-30832838,30833643-30833838,30833975-308341... 28 8.0 >03_02_0770 + 11038971-11039392,11040071-11040353,11040697-11040798 Length = 268 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 337 DADTGVASVTFSASGFTFLSSVLVSTAELCF 245 DAD GVA+V + G F S V ++ AE F Sbjct: 53 DADDGVAAVVLAGRGRAFCSGVDLTAAEEVF 83 >02_03_0305 + 17527906-17528148,17528986-17529051,17529624-17530808 Length = 497 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 506 KSSTEAXKEDATTPKSELAKSTEAPTA 586 K S ++ DATTP+++ ++EAP A Sbjct: 411 KKSADSRTADATTPRADARVASEAPAA 437 >01_06_0646 - 30832201-30832838,30833643-30833838,30833975-30834126, 30834258-30834303,30834992-30835216,30835374-30835414, 30835705-30835834,30835951-30836019,30836254-30836307, 30836389-30836547,30836854-30836991,30837079-30837141, 30837225-30837264,30837369-30837415,30838062-30838373 Length = 769 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +1 Query: 124 IALPAEQSGAQLGTTVPVPHDIPQAPGKPEENATAV 231 I LP E+ A LG V HD P APG + V Sbjct: 5 IILPKEEEAA-LGVAVEEDHDSPAAPGYQHQQGPPV 39 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,751,413 Number of Sequences: 37544 Number of extensions: 239429 Number of successful extensions: 653 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -