BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060327.seq (687 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93388-12|CAB07661.2| 294|Caenorhabditis elegans Hypothetical p... 27 9.5 AF098997-8|AAC68719.3| 335|Caenorhabditis elegans Serpentine re... 27 9.5 >Z93388-12|CAB07661.2| 294|Caenorhabditis elegans Hypothetical protein T10C6.4 protein. Length = 294 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 231 NCCCVFFRFTWSLRDIMRNGYCSSQL 154 NC FF+F W + RN C ++L Sbjct: 136 NCSFPFFQFGWVFMEAQRNETCGAKL 161 >AF098997-8|AAC68719.3| 335|Caenorhabditis elegans Serpentine receptor, class i protein54 protein. Length = 335 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -3 Query: 319 ASVTFSASGFTFLSSVLVSTAELCFVS*AELLLRFLQVY 203 A++ F +GF FL + + + +CFV + + + LQ Y Sbjct: 88 ATLHFGITGFAFLLTYQIGSMIICFVRKHQTIAKTLQQY 126 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,765,261 Number of Sequences: 27780 Number of extensions: 212639 Number of successful extensions: 699 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -