BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060322.seq (692 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79940.1 68414.m09342 DNAJ heat shock N-terminal domain-conta... 58 4e-09 At4g21180.1 68417.m03063 DNAJ heat shock N-terminal domain-conta... 54 1e-07 At1g59980.1 68414.m06757 DNAJ heat shock N-terminal domain-conta... 35 0.045 At5g59610.1 68418.m07469 DNAJ heat shock N-terminal domain-conta... 34 0.078 At3g02440.1 68416.m00231 expressed protein 34 0.078 At3g08970.1 68416.m01048 DNAJ heat shock N-terminal domain-conta... 34 0.10 At2g17880.1 68415.m02071 DNAJ heat shock protein, putative simil... 31 0.55 At1g24120.1 68414.m03043 DNAJ heat shock protein, putative simil... 31 0.55 At5g05750.1 68418.m00633 DNAJ heat shock N-terminal domain-conta... 30 1.3 At2g05250.1 68415.m00553 DNAJ heat shock N-terminal domain-conta... 30 1.7 At2g05230.1 68415.m00551 DNAJ heat shock N-terminal domain-conta... 30 1.7 At5g22140.1 68418.m02578 pyridine nucleotide-disulphide oxidored... 29 2.2 At2g42750.1 68415.m05294 DNAJ heat shock N-terminal domain-conta... 29 2.2 At1g21080.1 68414.m02637 DNAJ heat shock N-terminal domain-conta... 29 2.2 At5g49060.1 68418.m06070 DNAJ heat shock N-terminal domain-conta... 29 2.9 At5g12430.1 68418.m01461 DNAJ heat shock N-terminal domain-conta... 29 2.9 At4g36040.1 68417.m05130 DNAJ heat shock N-terminal domain-conta... 29 2.9 At3g57340.2 68416.m06383 DNAJ heat shock N-terminal domain-conta... 29 2.9 At3g57340.1 68416.m06382 DNAJ heat shock N-terminal domain-conta... 29 2.9 At3g44190.1 68416.m04738 pyridine nucleotide-disulphide oxidored... 29 2.9 At3g01170.1 68416.m00021 expressed protein 29 2.9 At2g22360.1 68415.m02653 DNAJ heat shock family protein similar ... 29 2.9 At5g42640.1 68418.m05191 zinc finger (C2H2 type) family protein ... 29 3.9 At4g39960.1 68417.m05660 DNAJ heat shock family protein similar ... 29 3.9 At3g44110.2 68416.m04728 DNAJ heat shock protein, putative (J3) ... 29 3.9 At3g44110.1 68416.m04727 DNAJ heat shock protein, putative (J3) ... 29 3.9 At3g62600.1 68416.m07032 DNAJ heat shock family protein similar ... 28 5.1 At1g76700.1 68414.m08925 DNAJ heat shock N-terminal domain-conta... 28 5.1 At1g68370.1 68414.m07809 gravity-responsive protein / altered re... 28 6.8 At5g22060.1 68418.m02569 DNAJ heat shock protein, putative stron... 27 8.9 At5g06910.1 68418.m00781 DNAJ heat shock protein, putative (J6) ... 27 8.9 At1g09840.3 68414.m01108 shaggy-related protein kinase kappa / A... 27 8.9 At1g09840.2 68414.m01107 shaggy-related protein kinase kappa / A... 27 8.9 At1g09840.1 68414.m01106 shaggy-related protein kinase kappa / A... 27 8.9 >At1g79940.1 68414.m09342 DNAJ heat shock N-terminal domain-containing protein / sec63 domain-containing protein similar to SP|Q9UGP8 Translocation protein SEC63 homolog {Homo sapiens}; contains Pfam profiles PF00226 DnaJ domain, PF02889 Sec63 domain Length = 702 Score = 58.4 bits (135), Expect = 4e-09 Identities = 32/83 (38%), Positives = 46/83 (55%), Gaps = 2/83 (2%) Frame = +3 Query: 264 CQCPNCVSKQLIIEQSQPYKSVKNF--FVKLAIVSGWVLLGFLAYKVSQFDYEMSNFDPY 437 CQC C + ++S +K + NF + L +V WV++ FL Y E FDP+ Sbjct: 44 CQCLEC-DRSGKYKRSL-FKKISNFSTWSNLTLVLLWVVMIFLIYYTKNMSREAQVFDPF 101 Query: 438 EILGLPPGATQAEIXKSYRKQSL 506 ILGL PG T +EI K+YR+ S+ Sbjct: 102 SILGLEPGVTDSEIKKAYRRLSI 124 >At4g21180.1 68417.m03063 DNAJ heat shock N-terminal domain-containing protein / sec63 domain-containing protein similar to SP|Q9UGP8 Translocation protein SEC63 homolog {Homo sapiens}; contains Pfam profiles PF00226 DnaJ domain, PF02889 Sec63 domain Length = 661 Score = 53.6 bits (123), Expect = 1e-07 Identities = 30/85 (35%), Positives = 44/85 (51%), Gaps = 4/85 (4%) Frame = +3 Query: 264 CQCPNCVS----KQLIIEQSQPYKSVKNFFVKLAIVSGWVLLGFLAYKVSQFDYEMSNFD 431 CQC C K+ I + + S N L +V W+++ FL Y E F+ Sbjct: 44 CQCLECDRSGKYKRSISQSISSFTSCSN----LTVVLLWIVMIFLIYHTKNMSRESQLFE 99 Query: 432 PYEILGLPPGATQAEIXKSYRKQSL 506 P+ ILGL PGA+ +EI K+YR+ S+ Sbjct: 100 PFGILGLEPGASDSEIKKAYRRLSI 124 >At1g59980.1 68414.m06757 DNAJ heat shock N-terminal domain-containing protein similar to Altered Response to Gravity [Arabidopsis thaliana] GI:4249662; contains Pfam profile PF00226 DnaJ domain Length = 414 Score = 35.1 bits (77), Expect = 0.045 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 414 EMSNFDPYEILGLPPGATQAEIXKSYRKQSL 506 E+ +PYE+LG+P +T EI +YR+ +L Sbjct: 18 ELRRRNPYEVLGIPSNSTDQEIKSAYRRMAL 48 >At5g59610.1 68418.m07469 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9UXR9 Chaperone protein dnaJ (Heat shock protein 40 Methanosarcina thermophila, SP|Q9QYI6 DnaJ homolog subfamily B member 9 Mus musculus; contains Pfam profile PF00226 DnaJ domain Length = 268 Score = 34.3 bits (75), Expect = 0.078 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +3 Query: 432 PYEILGLPPGATQAEIXKSYRKQSL 506 PYEILG+ P AT +I ++YRK +L Sbjct: 74 PYEILGVSPSATPQDIKRAYRKLAL 98 >At3g02440.1 68416.m00231 expressed protein Length = 373 Score = 34.3 bits (75), Expect = 0.078 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Frame = +3 Query: 375 LGFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIXKSYRK---QSLVCILTK 524 LGF+ ++ + ++ FDPYE L + G A + S + QSL+C+L++ Sbjct: 165 LGFMKWRWKPKECDLPLFDPYEFLEIVRGTRMAFVGDSVSRNHVQSLICLLSR 217 >At3g08970.1 68416.m01048 DNAJ heat shock N-terminal domain-containing protein low similarity to PIR|A47079|A47079 heat shock protein dnaJ - Lactococcus lactis; contains Pfam profile PF00226 DnaJ domain Length = 572 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +3 Query: 429 DPYEILGLPPGATQAEIXKSYRKQSL 506 DPY++LG+ A Q EI K++ KQSL Sbjct: 27 DPYKVLGVSKDAKQREIQKAFHKQSL 52 >At2g17880.1 68415.m02071 DNAJ heat shock protein, putative similar to J11 protein [Arabidopsis thaliana] GI:9843641; contains Pfam profile PF00226 DnaJ domain Length = 160 Score = 31.5 bits (68), Expect = 0.55 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 435 YEILGLPPGATQAEIXKSYRKQSLVC 512 YEIL +P G+T EI +YR+ + +C Sbjct: 70 YEILEIPVGSTSQEIKSAYRRLARIC 95 >At1g24120.1 68414.m03043 DNAJ heat shock protein, putative similar to Altered Response to Gravity [Arabidopsis thaliana] GI:4249662; contains Pfam profile PF00226 DnaJ domain Length = 436 Score = 31.5 bits (68), Expect = 0.55 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 429 DPYEILGLPPGATQAEIXKSYRKQSL 506 DPYE+LG+ +T EI +YRK +L Sbjct: 20 DPYEVLGVLRNSTDQEIKSAYRKLAL 45 >At5g05750.1 68418.m00633 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 Mus musculus; contains Pfam profile PF00226 DnaJ domain Length = 294 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +3 Query: 420 SNFDPYEILGLPPGATQAEIXKSYRKQSL 506 S D YEILGL + ++ KSYRK SL Sbjct: 111 SKKDYYEILGLKSNCSVEDLRKSYRKLSL 139 >At2g05250.1 68415.m00553 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 706 Score = 29.9 bits (64), Expect = 1.7 Identities = 20/60 (33%), Positives = 29/60 (48%) Frame = +3 Query: 330 KNFFVKLAIVSGWVLLGFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIXKSYRKQSLV 509 K+ F L +S V F Y SQ D Y +LGL P A + E+ K Y+K +++ Sbjct: 35 KSLFPDLEGLSQMVAT-FEVYLASQ-TRSGGQIDYYAVLGLKPSAGKREVKKQYKKMAVL 92 >At2g05230.1 68415.m00551 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 706 Score = 29.9 bits (64), Expect = 1.7 Identities = 20/60 (33%), Positives = 29/60 (48%) Frame = +3 Query: 330 KNFFVKLAIVSGWVLLGFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIXKSYRKQSLV 509 K+ F L +S V F Y SQ D Y +LGL P A + E+ K Y+K +++ Sbjct: 35 KSLFPDLEGLSQMVAT-FEVYLASQ-TRSGGQIDYYAVLGLKPSAGKREVKKQYKKMAVL 92 >At5g22140.1 68418.m02578 pyridine nucleotide-disulphide oxidoreductase family protein contains Pfam profile PF00070 Pyridine nucleotide-disulphide oxidoreductase domain Length = 365 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/55 (25%), Positives = 30/55 (54%) Frame = +3 Query: 345 KLAIVSGWVLLGFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIXKSYRKQSLV 509 K +V G + G LA K+ QFD E++ DP E + + ++ + + +++++ Sbjct: 12 KRVVVIGGGIAGSLAAKLLQFDAEVTLIDPKEYFEITWASLRSMVEPKFAERTVI 66 >At2g42750.1 68415.m05294 DNAJ heat shock N-terminal domain-containing protein low similarity to GFA2 [Arabidopsis thaliana] GI:21429604; contains Pfam profile PF00226: DnaJ domain Length = 344 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +3 Query: 429 DPYEILGLPPGATQAEIXKSY 491 D Y +LGL P ATQ EI K+Y Sbjct: 76 DYYAVLGLLPDATQEEIKKAY 96 >At1g21080.1 68414.m02637 DNAJ heat shock N-terminal domain-containing protein similar to SP|P39101 CAJ1 protein [Saccharomyces cerevisiae]; contains Pfam profile PF00226 DnaJ domain; Length = 391 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +3 Query: 435 YEILGLPPGATQAEIXKSY 491 Y++LG+ P AT+AEI K+Y Sbjct: 8 YDVLGVSPTATEAEIKKAY 26 >At5g49060.1 68418.m06070 DNAJ heat shock N-terminal domain-containing protein low similarity to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 354 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +3 Query: 423 NFDPYEILGLPPGATQAEIXKSYRKQSL 506 N D Y ILGL + EI K+YRK SL Sbjct: 97 NNDYYAILGLEKNCSVDEIRKAYRKLSL 124 >At5g12430.1 68418.m01461 DNAJ heat shock N-terminal domain-containing protein similarity to TETRATRICOPEPTIDE REPEAT PROTEIN 2 , human, SWISSPROT:TTC2_HUMAN; contains Pfam profiles PF00226: DnaJ domain, PF00515: TPR Domain Length = 1165 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +3 Query: 420 SNFDPYEILGLPPGATQAEIXKSYRKQSL 506 ++ D Y +LG+ P + ++I K+YRK +L Sbjct: 1021 NSLDMYLVLGVVPSCSASDIRKAYRKAAL 1049 >At4g36040.1 68417.m05130 DNAJ heat shock N-terminal domain-containing protein (J11) identical to dnaJ heat shock protein J11 [Arabidopsis thaliana] GI:9843641; contains Pfam profile PF00226 DnaJ domain Length = 161 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +3 Query: 435 YEILGLPPGATQAEIXKSYRKQSLVC 512 Y++L +P GAT +I +YR+ + +C Sbjct: 67 YDVLEVPLGATSQDIKSAYRRLARIC 92 >At3g57340.2 68416.m06383 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 Mus musculus; contains Pfam profile PF00226 DnaJ domain Length = 367 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +3 Query: 420 SNFDPYEILGLPPGATQAEIXKSYRKQSL 506 S D YEILGL + ++ K+YRK SL Sbjct: 110 SKKDYYEILGLESNCSVDDVRKAYRKLSL 138 >At3g57340.1 68416.m06382 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 Mus musculus; contains Pfam profile PF00226 DnaJ domain Length = 367 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +3 Query: 420 SNFDPYEILGLPPGATQAEIXKSYRKQSL 506 S D YEILGL + ++ K+YRK SL Sbjct: 110 SKKDYYEILGLESNCSVDDVRKAYRKLSL 138 >At3g44190.1 68416.m04738 pyridine nucleotide-disulphide oxidoreductase family protein low similarity to dihydrolipoamide dehydrogenase from Clostridium magnum [GI:472330]; contains Pfam profile PF00070 Pyridine nucleotide-disulphide oxidoreductase domain Length = 367 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/55 (27%), Positives = 30/55 (54%) Frame = +3 Query: 345 KLAIVSGWVLLGFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIXKSYRKQSLV 509 K IV G + G LA K QFD +++ DP E + + ++ + ++ ++S++ Sbjct: 12 KRVIVIGGGIAGSLASKFLQFDSDLTLIDPKEYFEIIWASLRSMVEPAFAERSVI 66 >At3g01170.1 68416.m00021 expressed protein Length = 215 Score = 29.1 bits (62), Expect = 2.9 Identities = 28/85 (32%), Positives = 38/85 (44%), Gaps = 1/85 (1%) Frame = +3 Query: 54 GFKFYPLVYLMLLKS-E*FDTYNGRSKIRI*RKWIYILLFCFIISCINISTSYILLLA*K 230 GF F+P V L+ LKS E F + K I + I I C IST ++LL Sbjct: 66 GFLFFPYVKLITLKSIEVFSDLSLLVKQEILQNPIVYGSLALSIFCAAISTWLVILL--- 122 Query: 231 TKRRSCKIAERCQCPNCVSKQLIIE 305 C + +RC PNC + +E Sbjct: 123 -----CTM-QRCGKPNCKGLRKAVE 141 >At2g22360.1 68415.m02653 DNAJ heat shock family protein similar to SP|Q9S5A3 Chaperone protein dnaJ {Listeria monocytogenes}; contains Pfam profiles PF00226 DnaJ domain, PF01556 DnaJ C terminal region, PF00684 DnaJ central domain (4 repeats) Length = 442 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 429 DPYEILGLPPGATQAEIXKSYRK 497 D Y +LG+ AT+AEI +YRK Sbjct: 86 DYYSVLGVSKNATKAEIKSAYRK 108 >At5g42640.1 68418.m05191 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 300 Score = 28.7 bits (61), Expect = 3.9 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 5/44 (11%) Frame = -2 Query: 616 VPQR--IYLNDTTKCQPGMPFVSSHESLLVTSFFV---RMQTRD 500 +P R IY DTT + +P +H S +V S F+ RM RD Sbjct: 4 IPNRFNIYGGDTTNHRESLPIEMNHNSRMVRSMFITSDRMNHRD 47 >At4g39960.1 68417.m05660 DNAJ heat shock family protein similar to SP|Q9S5A3 Chaperone protein dnaJ {Listeria monocytogenes}; contains Pfam profiles PF00226 DnaJ domain, PF01556 DnaJ C terminal region, PF00684 DnaJ central domain (4 repeats) Length = 447 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 429 DPYEILGLPPGATQAEIXKSYRK 497 D Y +LG+ AT+AEI +YRK Sbjct: 85 DFYSVLGVSKNATKAEIKSAYRK 107 >At3g44110.2 68416.m04728 DNAJ heat shock protein, putative (J3) identical to AtJ3 [Arabidopsis thaliana] GI:2641638, strong similarity to several plant DnaJ proteins from PGR; contains Pfam profiles PF00226 DnaJ domain, PF00684 DnaJ central domain (4 repeats), PF01556 DnaJ C terminal region Length = 343 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 435 YEILGLPPGATQAEIXKSYRKQSL 506 YEILG+P A+ ++ K+Y+K ++ Sbjct: 16 YEILGVPKSASPEDLKKAYKKAAI 39 >At3g44110.1 68416.m04727 DNAJ heat shock protein, putative (J3) identical to AtJ3 [Arabidopsis thaliana] GI:2641638, strong similarity to several plant DnaJ proteins from PGR; contains Pfam profiles PF00226 DnaJ domain, PF00684 DnaJ central domain (4 repeats), PF01556 DnaJ C terminal region Length = 420 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 435 YEILGLPPGATQAEIXKSYRKQSL 506 YEILG+P A+ ++ K+Y+K ++ Sbjct: 16 YEILGVPKSASPEDLKKAYKKAAI 39 >At3g62600.1 68416.m07032 DNAJ heat shock family protein similar to DnaJ homolog subfamily B member 11 precursor (SP:Q99KV1){Mus musculus}; contains Pfam PF00226: DnaJ domain; contains PfaPF01556: DnaJ C terminal regionm Length = 346 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +3 Query: 366 WVLLGFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIXKSYRKQSL 506 W L + + +S ++ Y++L +P GA+ +I ++YRK +L Sbjct: 5 WSELCIVLFALSYAICVLAGKSYYDVLQVPKGASDEQIKRAYRKLAL 51 >At1g76700.1 68414.m08925 DNAJ heat shock N-terminal domain-containing protein similar to SP|P39101 CAJ1 protein, Saccharomyces cerevisiae; contains Pfam profile PF00226 DnaJ domain Length = 398 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +3 Query: 435 YEILGLPPGATQAEIXKSY 491 Y++LG+ P AT++EI K+Y Sbjct: 8 YDVLGVSPTATESEIKKAY 26 >At1g68370.1 68414.m07809 gravity-responsive protein / altered response to gravity protein (ARG1) identical to Altered Response to Gravity [Arabidopsis thaliana] GI:4249662; contains Pfam profile PF00226 DnaJ domain Length = 410 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 429 DPYEILGLPPGATQAEIXKSYRKQSL 506 DPYE+L + A EI +YRK +L Sbjct: 17 DPYEVLCVSKDANDQEIKSAYRKLAL 42 >At5g22060.1 68418.m02569 DNAJ heat shock protein, putative strong similarity to SP|O60884 DnaJ homolog subfamily A member 2 (Dnj3) Homo sapiens, several plant DnaJ proteins from PGR; contains Pfam profiles PF00226 DnaJ domain, PF00684 DnaJ central domain (4 repeats), PF01556 DnaJ C terminal region Length = 419 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 435 YEILGLPPGATQAEIXKSYRKQSL 506 YEILG+P A ++ K+Y+K ++ Sbjct: 16 YEILGVPKTAAPEDLKKAYKKAAI 39 >At5g06910.1 68418.m00781 DNAJ heat shock protein, putative (J6) identical to DnaJ homologue [Arabidopsis thaliana] GI:2689720; contains Pfam profile PF00226 DnaJ domain Length = 284 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 435 YEILGLPPGATQAEIXKSYRKQSL 506 YE+LG+ AT EI K+Y K +L Sbjct: 31 YEVLGVERRATSQEIRKAYHKLAL 54 >At1g09840.3 68414.m01108 shaggy-related protein kinase kappa / ASK-kappa (ASK10) identical to shaggy-related protein kinase kappa SP:Q39019 GI:717180 from [Arabidopsis thaliana] Length = 421 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 423 NFDPYEILGLPPGATQAEIXKSYRKQSLVCIL 518 NF P E+ G+PP + + RKQ+L L Sbjct: 388 NFKPQELSGIPPEIVNRLVPEHARKQNLFMAL 419 >At1g09840.2 68414.m01107 shaggy-related protein kinase kappa / ASK-kappa (ASK10) identical to shaggy-related protein kinase kappa SP:Q39019 GI:717180 from [Arabidopsis thaliana] Length = 421 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 423 NFDPYEILGLPPGATQAEIXKSYRKQSLVCIL 518 NF P E+ G+PP + + RKQ+L L Sbjct: 388 NFKPQELSGIPPEIVNRLVPEHARKQNLFMAL 419 >At1g09840.1 68414.m01106 shaggy-related protein kinase kappa / ASK-kappa (ASK10) identical to shaggy-related protein kinase kappa SP:Q39019 GI:717180 from [Arabidopsis thaliana] Length = 421 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 423 NFDPYEILGLPPGATQAEIXKSYRKQSLVCIL 518 NF P E+ G+PP + + RKQ+L L Sbjct: 388 NFKPQELSGIPPEIVNRLVPEHARKQNLFMAL 419 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,557,794 Number of Sequences: 28952 Number of extensions: 290180 Number of successful extensions: 700 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 681 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 700 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -