BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060318.seq (639 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40800-9|AAA81494.1| 316|Caenorhabditis elegans Hypothetical pr... 31 0.53 AF039046-14|AAB94214.1| 388|Caenorhabditis elegans Prion-like-(... 27 8.6 >U40800-9|AAA81494.1| 316|Caenorhabditis elegans Hypothetical protein D2096.8 protein. Length = 316 Score = 31.5 bits (68), Expect = 0.53 Identities = 19/72 (26%), Positives = 29/72 (40%) Frame = +2 Query: 236 LENSSEEFVDIEAKFYSEVHAXXXXXXXXXXXXXXXRALIVNGTYEPNDDECLNPWRDDT 415 L+N + + IE+ FY VH R IV G EP ++ P + Sbjct: 33 LKNLQMKTIQIESDFYKRVHELEIEFEGKFKSTFDQRKAIVAGEVEPTKEQIDTPILEGL 92 Query: 416 EEEELARAVQNA 451 E ++LA + A Sbjct: 93 EGDQLAELYKAA 104 >AF039046-14|AAB94214.1| 388|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 54 protein. Length = 388 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/54 (27%), Positives = 22/54 (40%) Frame = -2 Query: 332 EACKVFHICIRVHVLHCKTWPQCRQTLLKSSQGADSPTNIWG*GCHRFCMKAIC 171 +A +V HI + + + PQC+Q S P N C+ C IC Sbjct: 174 QAPQVVHIQLEIQQAQAQCQPQCQQQCQSSCTQQQQPANQCNSACNSQCSN-IC 226 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,064,843 Number of Sequences: 27780 Number of extensions: 246710 Number of successful extensions: 663 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -