BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060314.seq (685 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCPB1C11.01 |amt1||ammonium transporter Amt1|Schizosaccharomyce... 29 0.83 SPCC1742.01 ||SPCC1795.13, SPCPB16A4.07c|sequence orphan|Schizos... 27 2.5 SPCC550.14 |||vigilin |Schizosaccharomyces pombe|chr 3|||Manual 27 2.5 SPCC830.11c |||adenylate kinase |Schizosaccharomyces pombe|chr 3... 26 4.4 SPAC664.03 |||RNA polymerase II associated Paf1 complex |Schizos... 25 7.7 >SPCPB1C11.01 |amt1||ammonium transporter Amt1|Schizosaccharomyces pombe|chr 3|||Manual Length = 497 Score = 28.7 bits (61), Expect = 0.83 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 385 G*NLARNLNCSGFSFLTSCCITFLYNLI 302 G LA ++C+ +SF SC + F+ N I Sbjct: 385 GYQLADTVSCAAYSFAVSCALLFVMNYI 412 >SPCC1742.01 ||SPCC1795.13, SPCPB16A4.07c|sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 1563 Score = 27.1 bits (57), Expect = 2.5 Identities = 19/47 (40%), Positives = 21/47 (44%) Frame = -3 Query: 236 VFTT*SKSCFPVVVCWIANSSSASIVVTRTFICFPPATILIVMITHT 96 V T S SC P V + S S S C PP TILIV + T Sbjct: 162 VADTTSTSCNPATVLIVTTSGSTSTS------CPPPTTILIVTVPTT 202 >SPCC550.14 |||vigilin |Schizosaccharomyces pombe|chr 3|||Manual Length = 1279 Score = 27.1 bits (57), Expect = 2.5 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = -1 Query: 577 SLARNPGPVQSGIVFSVSGLDRVEASNTEVSGGQYISSDKIAF 449 +L GP + IV V R ASNT V+G +S DKI F Sbjct: 89 TLLSKTGPSKPRIVSWV----RKTASNTSVAGSDSVSRDKIPF 127 >SPCC830.11c |||adenylate kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 175 Score = 26.2 bits (55), Expect = 4.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 333 DVKKENPLQFKFRAKFYPEDVDDELI 410 DV KEN L F F K+ DVD++ + Sbjct: 41 DVVKENHLHFGFDEKWKTYDVDEDKV 66 >SPAC664.03 |||RNA polymerase II associated Paf1 complex |Schizosaccharomyces pombe|chr 1|||Manual Length = 457 Score = 25.4 bits (53), Expect = 7.7 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -2 Query: 183 ELEFRVHRRHADVHLFSSGNHFDSYDHT-HTADKITSTLCIIF 58 E++ +V+ ADVH NHF ++D + H LC+ F Sbjct: 263 EIQAKVNDASADVHEPFVYNHFRNFDASMHVNSTGLEDLCLTF 305 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,831,803 Number of Sequences: 5004 Number of extensions: 58202 Number of successful extensions: 184 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 184 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -