BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060313.seq (688 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pom... 28 1.5 SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces ... 28 1.5 >SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pombe|chr 2|||Manual Length = 1692 Score = 27.9 bits (59), Expect = 1.5 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +2 Query: 272 LHPQTSLVNVKSSDLKTVSTNNV--FVHFNSCQWAAH 376 LHPQ+SL V SD+ N V FV+ N AH Sbjct: 1020 LHPQSSLYCVLDSDISAGKNNRVLKFVYDNLASCLAH 1056 >SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces pombe|chr 1|||Manual Length = 1888 Score = 27.9 bits (59), Expect = 1.5 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = -2 Query: 681 NKLPIFNSRSHYLFPAKLNTSLTNLTMFLQLHISPLPSVA**FCNIQHFI 532 NK P+ + R +YL + + S+TN T S LPS CN+Q+F+ Sbjct: 1708 NKRPLLSGRIYYLISSFVAISMTNKT-------SGLPSSL--ICNLQNFL 1748 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,400,653 Number of Sequences: 5004 Number of extensions: 45460 Number of successful extensions: 92 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -